2QRY


Conserved Protein Domain Family
thiB

?
TIGR01276: thiB 
Click on image for an interactive view with Cn3D
thiamine ABC transporter, periplasmic binding protein
This model finds the thiamine (and thiamine pyrophosphate) ABC transporter periplasmic binding protein ThiB in proteobacteria. Completed genomes having this protein (E. coli, Vibrio cholera, Haemophilus influenzae) also have the permease ThiP, described by TIGRFAMs equivalog model TIGR01253. [Transport and binding proteins, Other]
Statistics
?
PSSM-Id: 130343
View PSSM: TIGR01276
Aligned: 3 rows
Threshold Bit Score: 611.26
Threshold Setting Gi: 1174615
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2QRY_A      22 KPVLTVYTYDSFAADWGPGPVVKKAFE-ADCNCELKLVALEDGVSLLNRLRXEGKNSKADVVLGLDNNLLDAASKTGLFA 100
gi 2507359  19 KPVLTVYTYDSFAADWGPGPVVKKAFE-ADCNCELKLVALEDGVSLLNRLRMEGKNSKADVVLGLDNNLLDAASKTGLFA 97
gi 1174615  23 QQSVNVYSYDSFTSEWGAGPKVKQDFEkAHPQCAINFTPFESVGVLLNRVRLEGKKTKADIVLGLDNFFLEQAEKTGIFA 102
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2QRY_A     101 KSGVAADAVNVPGGWNNDTFVPFDYGYFAFVYDKNKLKNPPQSLKELVEsDQNWRVIYQDPRTSTPGLGLLLWXQKVY-G 179
gi 2507359  98 KSGVAADAVNVPGGWNNDTFVPFDYGYFAFVYDKNKLKNPPQSLKELVEsDQNWRVIYQDPRTSTPGLGLLLWMQKVY-G 176
gi 1174615 103 PNNVDLTQLDLPTKWANKTFLPFDFGNYAFVYDKTKLQNPPKSLKELVE-RQDLSVIYQDPRTSSVGRGLLVWMNAVYpA 181
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2QRY_A     180 DDAPQAWQKLAKKTVTVTKGWSEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAAANFSEGHYLQVEVAARTAASKQp 259
gi 2507359 177 DDAPQAWQKLAKKTVTVTKGWSEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAAANFSEGHYLQVEVAARTAASKQp 256
gi 1174615 182 DKIQSAWKELDKHTVTVGKGWSDTYGAFLKGEADLVLSYSTSPLYHQLFEKKDNYAATDFAEGHITQVELAARVANHPN- 260
                      250       260       270       280       290       300       310
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
2QRY_A     260 ELAQKFLQFXVSPAFQNAIPTGNWXYPVANVTLPAGFEKLTKPATT-LEFTPAEVAAQRQAWISEWQRAVSR 330
gi 2507359 257 ELAQKFLQFMVSPAFQNAIPTGNWMYPVANVTLPAGFEKLTKPATT-LEFTPAEVAAQRQAWISEWQRAVSR 327
gi 1174615 261 QCADDFMAFLISPTAQKHIVTANIMLPVIQGEIEPHFDALKVQQKTqTSINPMVNTEQLKNWISTWQTTLTK 332
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap