Conserved Protein Domain Family
thiQ

?
TIGR01277: thiQ 
thiamine ABC transporter, ATP-binding protein
This model describes the energy-transducing ATPase subunit ThiQ of the ThiBPQ thiamine (and thiamine pyrophosphate) ABC transporter in several Proteobacteria. This protein is found so far only in Proteobacteria, and is found in complete genomes only if the ThiB and ThiP subunits are also found. [Transport and binding proteins, Other]
Statistics
?
PSSM-Id: 130344
View PSSM: TIGR01277
Aligned: 3 rows
Threshold Bit Score: 377.665
Threshold Setting Gi: 125987865
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125987865   2 IYLNNVILNDKTLPMCFNLSVNAGERVAIIGESGAGKSTLLNLIAGFEFPAQGEIWLNDKNHTRSAPYERPVSMLFQENN 81
gi 446839011   2 LKLTDITWLYHHLPMRFSLTVERGEQVAILGPSGAGKSTLLNLIAGFLTPASGALTIDGVDHTTTPPSRRPVSMLFQENN 81
gi 446803030   2 LALDKVRYEYEHEWFEFDLNVADGDIVALMGPSGAGKSTLLSLVAGFIEPVSGSIKVNDQSVLGLAPYQRPFSMLFQEHN 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125987865  82 LFPHLTVQQNLALGIKPSLKLTALEQEKIEQVACSVGLGDYLERLPNSLSGGQKQRVALARCLLRDKPILLLDEPFSALD 161
gi 446839011  82 LFSHLTVAQNIGLGLNPGLKLNAVQQEKMHAIARQMGIDNLMARLPGELSGGQRQRVALARCLVREQPILLLDEPFSALD 161
gi 446803030  82 LFAHLTVRENIGLGLHPGLKLNAEQKQQVVDAAQQVGIADYLDRLPEQLSGGQRQRVALARCFVQPNPIWLLDEPFSALD 161
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|...
gi 125987865 162 QKLRVEMLALIAKLCDEKDLTLLLVTHQPSELIGSIDQVLVVENGQISQLQKG 214
gi 446839011 162 PALRQEMLTLVSTSCQQQKMTLLMVSHSVEDAARIATRSVVVADGRIAWQGMT 214
gi 446803030 162 PLLREEMLALVKQLASERQRTVVMVTHHLSDARAIASQIAFLSQGKVKVVSDC 214
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap