Conserved Protein Domain Family
DPOR_bchL

?
TIGR01281: DPOR_bchL 
light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein
The BchL peptide (ChlL in chloroplast and cyanobacteria) is an ATP-binding iron-sulfur protein of the dark form protochlorophyllide reductase, an enzyme similar to nitrogenase. This subunit resembles the nitrogenase NifH subunit. [Biosynthesis of cofactors, prosthetic groups, and carriers, Chlorophyll and bacteriochlorphyll]
Statistics
?
PSSM-Id: 130348
View PSSM: TIGR01281
Aligned: 4 rows
Threshold Bit Score: 480.463
Threshold Setting Gi: 13878351
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13878359   1 MIIAVYGKGGVGKSTTTSNLAVAIAKEGKRVLQIGCDPKSDSTFTIAGKMIPTVVEILDKFNYHYESIEPGDLIFTGYGG 80
gi 13878351  25 KVFAIYGKGGIGKSTTSSNLSAAFSKLGKRVVQIGCDPKHDSTFTLTKRLVPTVIDVLQAVHFHTEELRVEDFVYEGYNG 104
gi 13878340   3 LILAIYGKGGIGKSTTSANLSAAMALKGAKVLQIGCDPKHDSTFPLTGHLQPTVIDVLDSVNFHLEDVSKEDVIRTGFAG 82
gi 1705820    1 MKLSVYGKGGIGKSTTSCNISVALARRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQAKDYHYEDVWPEDVIYRGYGG 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13878359  81 VDVVETGGPPAGSGCGGYVVGETVKLLEKMDVMARYDVILFDVLGDVVCGGFATPLQYADLACVVSSNDFDALFAANRIC 160
gi 13878351 105 VMCVEAGGPPAGTGCGGYVVGQTVKLLKEHHILEDADVVVFDVLGDVVCGGFATPLQHAERALVVAANDFDSIFAANRIA 184
gi 13878340  83 VDTLESGGPPAGSGCGGYVVGETVKLLKEFGLYDKYDVIVFDVLGDVVCGGFSAPLNYADYGLIIACNDFDSIFAANRLC 162
gi 1705820   81 VDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFDEYDVILFDVLGDVVCGGFAAPLNYSDYCLIITDNGFDALFAANRIA 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13878359 161 ESVVEKNMSgYDVKMAGVIGNRCDQV-----DLLETFTRRIETPLMGVVPRKEEIRQSRVKGYTLFELEEMGePVQDMTA 235
gi 13878351 185 AAIQAKAKN-YDVRLGGIIANRSVAT-----DQIERFNARSGMRTLAHFPDLDVIRRSRLCKSTLFEMEPSP-ELAAVQQ 257
gi 13878340 163 LAISQKSQR-HKVKLAGIIANRVDYEygggtNLLDQFAEKVGTKVIGRVPYHDLIRRSRLAGKTLFEME--GpGKEECTR 239
gi 1705820  161 ASVREKART-HTLRLAGLIGNRTSKR-----DLIDKYIEAVPMPVLEVLPLIEDIRISRVKGKTVFEMAETEpSLLTVCD 234
                       250       260       270
                ....*....|....*....|....*....|....
gi 13878359 236 EFRKMARYLLSkPDGVIPNAVGTREMFELFKgED 269
gi 13878351 258 EYLRLAEALWEgVEPLTATPLIDREIFDLLG-FD 290
gi 13878340 240 PFEEMAEYLLAqPQATVPQPYHDRAIFEAIGgWR 273
gi 1705820  235 YYLNIADQILArPEGVVPKDAADRDLFSLLSdFY 268
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap