Conserved Protein Domain Family
nodJ

?
TIGR01291: nodJ 
ABC-2 type transporter, NodJ family
Nearly all members of this subfamily are NodJ which, together with NodI (TIGR01288), acts to export a variety of modified carbohydrate molecules as signals to plant hosts to establish root nodules. The seed alignment includes a highly divergent member from Azorhizobium caulinodans that is, nonetheless, associated with nodulation. This model is designated as subfamily in part because not all sequences derived from the last common ancestral sequence of Rhizobium sp. and Azorhizobium caulinodans NodJ are necessarily nodulation proteins. [Cellular processes, Other, Transport and binding proteins, Other]
Statistics
?
PSSM-Id: 130358
View PSSM: TIGR01291
Aligned: 3 rows
Threshold Bit Score: 377.309
Threshold Setting Gi: 585571
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6225777  10 PANGWNWIAVWRRNYLAWKKVALASILGNLADPLIYLFGLGAGLGMMVGRVDGVSYIAFLSAGMVATSAMTASTFETIYA 89
gi 1709323  10 PSGLLNWVAVWRRNFLAWKKVAPASLLGNLADPMIYIFGLGSGLGVMLGNVGGVSYSAFLAAGMVATSAMTASTFETIYA 89
gi 585571    2 RERMVTWAAVFQRNAMSWRREMAASVLGSVIDPLIMLFGLGVGLGKIVDSVDGRSYAEFLACGLILTSAMSASNYEMLYG 81
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6225777  90 TFARMRAQRTWEAILHTQVTIGDIVLGELAWAATKASLAGTGIGVVAATLGYTEWVSLLYALPVIALTGLAFASLAMIVT 169
gi 1709323  90 TFARMRDHRTWEAMLYTKLTLGDIVLGEMAWAATKASLAGTAIGIVTATLAYSEWDSLIYVFPVIALTGLAFASLSMVVA 169
gi 585571   82 TYSRIYVTGTLKSMRYAPICVSDYLIGEVLWAAYEGVVAGTIVAVCTAFLGYIPGWSVIYILPDILFVALIFSSTSLLVA 161
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6225777 170 ALAPSYEYFIFYQTLVITPMLFLSGAVFPVNQLPGAFQHVTRILPLAHSIDVIRPIMLGSPLVHVGLHIGALCCYAVVPF 249
gi 1709323 170 ALAPSYDYLVFYQSLVITPMLVLSGSVFPVEQLSPMLQRITHLLPLAHSIDLIRPAMLGHPVPDITLHLGALCLYIVLPF 249
gi 585571  162 AISRGYALFAFYQSIAIAPLVFLSGVIVPRFTGNDVISGMIHFSPLYRAVNDVRNVVYEGRGTQVGPLLLLSLLYASVMV 241
                      250
               ....*....|...
gi 6225777 250 FLSTALLRRRLMP 262
gi 1709323 250 FVSIALLRRRLTQ 262
gi 585571  242 FISAKVICVRLDD 254
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap