2BLE


Conserved Protein Domain Family
GMP_reduct_1

?
TIGR01305: GMP_reduct_1 
Click on image for an interactive view with Cn3D
guanosine monophosphate reductase, eukaryotic
A deep split separates two families of GMP reductase. This family includes both eukaryotic and some proteobacterial sequences, while the other family contains other bacterial sequences. [Purines, pyrimidines, nucleosides, and nucleotides, Nucleotide and nucleoside interconversions]
Statistics
?
PSSM-Id: 130372
View PSSM: TIGR01305
Aligned: 4 rows
Threshold Bit Score: 682.802
Threshold Setting Gi: 42616
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2BLE_A      25 RIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFTFRNSKQTYSGIPIIVANMDTVGTFEMAAVMSQHSMFTAIHKHYSL 104
gi 544455    3 RIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFTFRNSKQTYSGIPIIVANMDTVGTFEMAAVMSQHSMFTAIHKHYSL 82
gi 42616     2 RIEEDLKLGFKDVLIRPKRSTLKSRSDVELERQFTFKHSGQSWSGVPIIAANMDTVGTFSMASALASFDILTAVHKHYSV 81
gi 8928126   3 RIENEPKLDFKDVLLRPKRSTLKSRADVELDREYVFRNSKATYTGVPVVASNMDTVGTFEMAAALNNHKIFTTIHKHYSV 82
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2BLE_A     105 DDWKLFATn-HPECLQNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYSEHFVEFVKLVRAKFPEHTIMAGNVVT 183
gi 544455   83 DDWKLFATn-HPECLQNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYSEHFVEFVKLVRAKFPEHTIMAGNVVT 161
gi 42616    82 EEWQAFINnsSADVLKHVMVSTGTSDADFEKTKQILDLNPALNFVCIDVANGYSEHFVQFVAKAREAWPTKTICAGNVVT 161
gi 8928126  83 DEWKAFAAsaSPDTFNNLAISSGISDNDWTKLNTVITELPQLKYICLDVANGYSESFVEFIRRVREAYPKHTIMAGNVVT 162
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2BLE_A     184 GEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKGHIISDGGCTCPGDVAKAFGAGADFVML 263
gi 544455  162 GEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKGHIISDGGCTCPGDVAKAFGAGADFVML 241
gi 42616   162 GEMCEELILSGADIVKVGIGPGSVCTTRVKTGVGYPQLSAVIECADAAHGLGGMIVSDGGCTTPGDVAKAFAR-ADFVML 240
gi 8928126 163 GEMVEELILSGADIVKVGIGPGSVCTTRKKAGVGYPQLSAVLECADAAHGLNGHVMSDGGCSNPGDVAKAFGAGADFVMI 242
                      250       260       270       280       290       300       310       320
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2BLE_A     264 GGMFSGHTECAGEVIERNGRKLKLFYGMSSDTAMNKHAGGVAEYRASEGKTVEVPYKGDVENTILDILGGLRSTCTYVGA 343
gi 544455  242 GGMFSGHTECAGEVFERNGRKLKLFYGMSSDTAMNKHAGGVAEYRASEGKTVEVPYKGDVENTILDILGGLRSTCTYVGA 321
gi 42616   241 GGMLAGHEESGGRIVEENGEKFMLFYGMSSESAMKRHVGGVAEYRAAEGKTVKLPLRGPVENTARDILGGLRSACTYVGA 320
gi 8928126 243 GGLFAGHDQSGGDLIEHNGKKFKLFYGMSSDTAMKKHHGSVAEYRASEGKTVTIPYRGDVNGTVQDILGGIRSACTYTGA 322
                      330       340
               ....*....|....*....|...
2BLE_A     344 AKLKELSRRATFIRVTQQHNTVF 366
gi 544455  322 AKLKELSRRATFIRVTQQHNTVF 344
gi 42616   321 SRLKELTKRTTFIRVQEQENRIF 343
gi 8928126 323 KHLKELAKRATFIRVTQQTNDMY 345
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap