Conserved Protein Domain Family
pgm_bpd_ind

?
TIGR01307: pgm_bpd_ind 
phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
This protein is about double in length of, and devoid of homology to the form of phosphoglycerate mutase that uses 2,3-bisphosphoglycerate as a cofactor. [Energy metabolism, Glycolysis/gluconeogenesis]
Statistics
?
PSSM-Id: 130374
View PSSM: TIGR01307
Aligned: 8 rows
Threshold Bit Score: 786.958
Threshold Setting Gi: 15790779
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2829465     3 QKTLLIITDGIGYRKDS---DHNAFFHAKKPTYDLMFKTLP-----YSLIDTHGLSVGLPKGQMGNSEVGHMCIGAGRVL 74
gi 586733      6 KPMVLVILDGYGYREEQ---QDNAIFSAKTPVMDALWANRP-----HTLIDASGLEVGLPDRQMGNSEVGHVNLGAGRIV 77
gi 3914388     7 APVVLVILDGWGYRPDT---RANAIAQANTPIMDSLIAAYP-----NTLVNTSGKDVGLPKGQMGNSEVGHLNLGAGRVV 78
gi 9955875     6 QKVVLVVIDGWGVAGPDsrkDGDAILAAETPFMSGFAEADSktaqgYSELDASSLAVGLPEGLMGNSEVGHLNIGAGRVV 85
gi 2499545     3 KKVLLAILDGYGISNKQ---HGNAVYHAKTPALDSLIKDYP-----CVMLEASGEAVGLPQGQIGNSEVGHLNIGAGRIV 74
gi 1709673     3 KKVLLAILDGYGISNAI---YGNAVQNANTPMLDELINSYP-----CVLLDASGEAVGLPMGQIGNSEVGHLNIGAGRVV 74
gi 489205427   6 KPLVLIILDGFGHSESP---DYNAIYAAKKPVWDRLLATQP-----HGLISGSGMDVGLPDGQMGNSEVGHMNLGAGRVV 77
gi 499205843   1 MQAALVILDGWGLGDHD---RRDAVRAADTPTFDEYAERGA-----FGTLTTSGRDVGLPDGQMGNSEVGHLTIGAGRVV 72
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2829465    75 YQDLVKISLSLQNDELKNNPAFLNTIQ---K-SPVVHLMGLMSDGGVHSHIEHFIALALECEKS-HKKVCLHLITDGRDV 149
gi 586733     78 YQDLTRLDVEIKDRAFFANPVLTGAVDkakNaGKAVHIMGLLSAGGVHSHEDHIMAMVELAAERgAEKIYLHAFLDGRDT 157
gi 3914388    79 PQELVRISDAIEDGTFFDNQALIEVCQrvrDrRGKLHLIGLCSDGGVHSHIDHLLGLIDLAKLQgISQLCIHAITDGRDT 158
gi 9955875    86 WQDSVRIDQTLKKGELNKVDNVVASFKrakEgNGRLHLLGLVSDGGVHSNITHLIGLLKVAKEMeIPKVFIHFFGDGRDT 165
gi 2499545    75 YTGLSLINQNIKTGAFHHNQVLLEAIArakAnNAKLHLIGLFSHGGVHSHMDHLYALIKLAAPQ--VKMVLHLFGDGRDV 152
gi 1709673    75 YTGLSLINQHIKDRSFFANKAFLKTIEhveKnHSKIHLIGLFSNGGVHSHNEHLLALIELFSKH--AKVVLHLFGDGRDV 152
gi 489205427  78 YQDFTRVTKAIRDGEFFENPVIAGAVDkavAaDKAVHILGLLSPGGVHSHEDHLVAMAQMAARRgAGKIYLHAFLDGRDT 157
gi 499205843  73 KQAYTRIEDAIAAGDLCGNDAISGALDhvaDtGGTLHVMGLVSDGGVHADQQHIHALVECAAGRgVEAAV-HAFTDGRDT 151
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2829465   150 APKSALTYLKQMQNICN--ESIQIATISGRFYAMDRDKRFERIELAYHSLMGLNH-TPLS-PSEYI--QSQYDKNITDEF 223
gi 586733    158 PPRSAESSLKKFEEKFAalGKGRVASIIGRYYAMDRDNRWDRVEKAYDLLTLAQGeFQADtAVAGL--QAAYARDENDEF 235
gi 3914388   159 PTNEGAHFVQQIQAHLEkiGLGRIVSVSGRYYALDRDRRWDRVEKAYRVMT-EDGvGDGRsAAQVI--KDYYASDITDEF 235
gi 9955875   166 EPKSATKYMQQLLDQTKeiGIGEIATVVGRYWAMDRDKRWDRVEIAMKGIVSGEG-EESSdPVKTI--NERYEKDETDEF 242
gi 2499545   153 APCTMKSDLEAFMVFLKdyHNVIIGTLGGRYYGMDRDQRWDREEIAYNAILGNSK-ASFTdPVAYV--QSAYDQKVTDEF 229
gi 1709673   153 APCSLKQDLEKLMIFLKnyPNVVIGTIGGRYYGMDRDQRWDREMIAYKALLGVSK-NKFNdPIGYI--ETQYQNQITDEF 229
gi 489205427 158 PPKSAQPSLERLDATFAglGKGRIASIIGRYFAMDRDNRWDRVQAAYELIVDGKAeFTADsSVAAL--EAAYARGESDEF 235
gi 499205843 152 SPTGGEDYLADLEAVADehGTGDVASVSGRYYAMDRDQNWARTKRAYDAITRSDG-VAHHaAAAVDavTDSYERGDTDEF 230
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2829465   224 IMPACFKNYC----G----MQDDESFIFINFRNDRAREIVSALGQ---KQFSGFKRQVFKKLH--IATMTPYDNTFPYPV 290
gi 586733    236 VKATVIRAEGqpdaA----MEDGDALIFMNFRADRAREITRAFVN---ADFDGFARKKVVNVD--FVMLTEYAADIKTAV 306
gi 3914388   236 IPPTRIGAg-----A----IASGDGVIFYNFRPDRARQLCYALVN---PSFDGFPRERIQPLD--FVTFTQYDPALPVVV 301
gi 9955875   243 LKPIIVGGee---rR----VKDDDTLFFFNYRSDRVREITQLLGDydrSPKPDFPYPKNIHIT----TMTQYKTDYTFPV 311
gi 2499545   230 LYPAVNGNVDkeqfA----LKDHDSVIFFNFRPDRARQMSHMLFQ---TDYYDYTPKAGRKYNlfFVTMMNYEGIKPSAV 302
gi 1709673   230 IYPAINANLNsdqfA----LNNNDGVISFNFRPDRARQMSHLIFN---SNYYNYQPELKRKENlfFVTMMNYEGIVPSEF 302
gi 489205427 236 VKATAVVPAG----AeavrVEDGDAVIFMNFRADRARELSRAFVE---PAFNEFPRERAPQLAg-FVMLTQYAASIPAPC 307
gi 499205843 231 VEPTTIEGGA----A----LSDGDAVVFANFRADRARQLTRLLADihpADWDADGIETNPPAVp-VVTMTEYDETFDCPV 301
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2829465   291 LFPKESVQNTLAEVVSQHNLTQSHIAETEKYAHVTFFINGGVETPFKNENRVLIQSPKVTTYDLKPEMSAKEVTLAVLEQ 370
gi 586733    307 AYPPASLVNTFGEWMAKNDKTQLRISETEKYAHVTFFFNGGVEESFKGEDRILINSPKVATYDLQPEMSSAELTEKLVAA 386
gi 3914388   302 AFEPQNLNNILGEIISRQGMKQFRTAETEKYPHVTYFFNGGLEQPFAGEDRELIQSPMVSTYDKAPQMSAKAVTDAVCRA 381
gi 9955875   312 AFPPQHMGNVLAEWLSKKDVQQCHVAETEKYAHVTFFFNGGIEKQFAGEVRDMIPSPKVATYDLDPKMSAEAVGQKMADR 391
gi 2499545   303 VFPPETIPNTFGEVIAHNKLKQLRIAETEKYAHVTFFFDGGVEVDLPNETKCMVPSLKVATYDLAPEMACKGITDQLLNQ 382
gi 1709673   303 AFPPQTIKNSLGEVIANNNLKQLRIAETEKYAHVTFFFDGGFEVNLSNETKTLIPSLKVATYDLAPEMSCKAITDALLEK 382
gi 489205427 308 AFPPEPLTNVLGEYLAKHGKTQLRIAETEKYAHVTFFFSGGREEPYEGEERILIPSPKVATYDLQPEMSAPEVTDRIVEA 387
gi 499205843 302 AFPAAEPTDTLGAVLAAHDHTQLRVAESEKYAHVTYFLNGGREVAFDGETRTIVDSPDVPTYDEQPAMSAPAVTDTVLDA 381
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2829465   371 MKLG-TDLIIVNFANGDMVGHTGNFEASVKAVEAVDACLGEILSLAKKLDYAMLLTSDHGNCERMKDEN-Q-NPLTNHTA 447
gi 586733    387 IKSGkYDTIICNYPNGDMVGHTGVMEAAVKAVEALDHCVEEVAKAVESVGGQLLITADHGNAEQMRDPA-TgQAHTAHTN 465
gi 3914388   382 MEKGiYSLVVVNYANPDMVGHTGKLKEAIQAIETVDLNLGRLLASAAKVGGTVLITADHGNAEYMSDES-G-NPWTAHTT 459
gi 9955875   392 IAEGkFEFVMNNFAPPDMVGHTGKYEAAIQGVAATDKAIGVIYEACKKQGYVLFITADHGNAEEMLTEK-G-TPKTSHTT 469
gi 2499545   383 INQ--FDLTVLNFANPDMVGHTGNYAACVQGLEALDVQIQRIIDFCKANHITLFLTADHGNAEEMIDSN-N-NPVTKHTV 458
gi 1709673   383 LNN--FDFTVLNFANPDMVGHTGNYQACIKALEALDVQIKRIVDFCKANQITMFLTADHGNAEVMIDNN-N-NPVTKHTI 458
gi 489205427 388 IEQQrYDVIVVNYANGDMVGHTGVFEAAVKAVECLDTCMGRIVEALDKVGGEALITADHGNVEQMEDEStG-QAHTAHTC 466
gi 499205843 382 LAGDdPDVLVLNYANPDMVGHTGDFDAAIEAVEAVDRELGRLVPALNDAGAHAFLTADHGNADDLGTPA-D--PHTAHTF 458
                        490       500       510       520       530
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 2829465   448 GSVYCFVLG-------DGv--K--SIkNGA-LNNIASSVLKLMGLKAPATMD-EPLF 491
gi 586733    466 LPVPLIYVGd------KNv--K--AV-EGGkLSDIAPTMLSLMGMEIPQEMTgKPLF 511
gi 3914388   460 NPVPFILVEgegrkipGHggeV--KLrEGGkLADIAPTILDILQLPVPAEMTgKTLI 514
gi 9955875   470 NKVPFIMANa-----pEGw--S--LKkEGGvLGDVAPTVLAAMGIEQPEEMSgQNLL 517
gi 2499545   459 NKVPFVCTD-------TNi--D--LQqDSAsLANIAPTILAYLGLKQPAEMTaNSLL 504
gi 1709673   459 NPVPFVCTD-------KNv--N--FNq-TGiLANIAPTILEYLNLSKPKEMTaKSLL 503
gi 489205427 467 EPVPFVYVGk------RK---L--SIrEGGvLADVAPTMLTLMGLEQPAEMTgRSIV 512
gi 499205843 459 NPVPFVSLPp------ASg--DtaAVrDGGaLRDIAPTLLDVLGIDRPTVMTgASLL 507
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap