Conserved Protein Domain Family
gntK_FGGY

?
TIGR01314: gntK_FGGY 
gluconate kinase, FGGY type
Gluconate is derived from glucose in two steps. This model describes one form of gluconate kinase, belonging to the FGGY family of carbohydrate kinases. Gluconate kinase phosphoryates gluconate for entry into the Entner-Douderoff pathway. [Energy metabolism, Sugars]
Statistics
?
PSSM-Id: 130381
View PSSM: TIGR01314
Aligned: 3 rows
Threshold Bit Score: 935.482
Threshold Setting Gi: 15674166
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121516      4 YMLGIDIGTTSTKAVLFSENGDVVQKESIGYPLYTPDISTAEQNPEEIFQAVIHTTARITKQHPEK-R-ISFISFSSAMH 81
gi 446799407   3 YMIGVDIGTTSTKSVLYDENGTFIMKHQIGYDLHTPNVDVSEENPDELFDAVLMTIKYVMRESKVNkDdIKFVSFSAQMH 82
gi 499208828   3 YLIGVDLGTTATKAVLFEKNGKIVASSSQAYPLYRDASGMAEESLEEIFEAVLVTIREVSINLEDE-DeLLAVSFSTQMH 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121516     82 SVIAIDENDKPLTPCITWADNRSEGWAHKIKEELNGHEVYKRTGTPIHPMAPLSKIAWITNERKEIASKAKKYIGIKEYI 161
gi 446799407  83 SLIAMDQQHQRLTNNITWADNRAAKYATVINEVHDGNAIYQRTGTPIHPMSPLAKIFWMKHEWQDVFQRTAKFADIKTYI 162
gi 499208828  82 SLIAFDENWQPLTRLITWADTRAVKYTEQIKASKNGFDIYRRTETPLHPMAPLSKFIWLEAEHPDIYQKAAHYLELKGYI 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121516    162 FKQLFNEYVIDYSLASATGMMNLKGLDWDEEALRIAGITPDHLSKLVPTTEIFQHCSPEIAIQMGIDPETPFVIGASDGV 241
gi 446799407 163 FYHLFDTYIIDYSMASATGMFNLETLDWDVEALELLGISKEMLPELVPTTYVMKGMKERYATLMGLNKDTPFVIGASDGV 242
gi 499208828 162 FQRLFGTNKMDLSTATGTGIFNIFELHWDKEALELTGIKESQLPKVVEPYEIEENLPHEYAKKMGIQSSTKFIWGAADGP 241
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121516    242 LSNLGVNAIKKGEIAVTIGTSGAIRTIIDKPQTDEKGRIFCYALTDKHWVIGGPVNNGGIVLRWIRDEFASSEIETATRL 321
gi 446799407 243 LSNLGVNSVGKGEVAVTIGTSGAIRTVIDKPRTDYKGRIFCYVLTEDHYVIGGPVNNGGVVLRWLRDELLASEVETAKRL 322
gi 499208828 242 LSNLGVNAIKPGVAAITIGTSGAIRVVTDKPKTDEKGRTFTYALDKEHWVVGGPVNSGGDVFRWARDQIFDGKIS----- 316
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121516    322 GIDPYDVLTKIAQRVRPGSDGLLFHPYLAGERAPLWNPDVRGSFFGLTMSHKKEHMIRAALEGVIYNLYTVFLALTECMD 401
gi 446799407 323 GVDPYDVLTQIAKRVKPGADGLIFHPYLAGERAPLWNANARGSFFGLTLSHKKEHMIRAALEGVLYNLYTVYLALIEVMN 402
gi 499208828 317 ----FDEVTELAANISPGADGLLFHPYLGGERAPIWDANARGSFFGLNYGHNRSHMARSVLEGVIFNIYMVALSLVEVVG 392
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121516    402 GPVTRIQATGGFARSEVWRQMMSDIFESEVVVPESYESSCLGACILGLYATGKIDSFDAVSDMIGSTYRHTPIEDSAKEY 481
gi 446799407 403 ETPKMIKATGGFAKSEVWRQMMSDIFDTELVVPESYESSCLGACVLGLKAVGDIEDFSIVSSMVGATNNHTPIEENVTVY 482
gi 499208828 393 D-LNMIQATGGFTSSELWTQILADIFEQPINVPESREAGCLAAIIMAEKALGLIEDISEIETMVGTNETYQPNPKNFEIY 471
                        490       500
                 ....*....|....*....|....*.
gi 121516    482 RTLMPIFINLSRLLENQYTQIADYQR 507
gi 446799407 483 QEIVSIFINLSRSLTENYEQIADFQR 508
gi 499208828 472 REISPIFIRLSRSLLAEYENIANFQR 497
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap