Conserved Protein Domain Family
cyt_b559_beta

?
TIGR01333: cyt_b559_beta 
cytochrome b559, beta subunit
This model describes the beta subunit of cytochrome b559, about 40 residues in length. It is homologous to the N-terminal half of the alpha subunit, a protein of about 83 residues. Cytochrome b559 is associated with photosystem II. [Energy metabolism, Photosynthesis]
Statistics
?
PSSM-Id: 130400
View PSSM: TIGR01333
Aligned: 2 rows
Threshold Bit Score: 58.8638
Threshold Setting Gi: 3024455
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40
               ....*....|....*....|....*....|....*....|...
gi 14195060  1 MANKplQPISYPIFTFRWLAIHGLAIPTVFFFGAITAMQFIQR 43
gi 3024455   1 MTAR--KSYTYPIFTVRWLAVHALAVPTVFFLGAITAMQFIQR 41
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap