Conserved Protein Domain Family
modD

?
TIGR01334: modD 
putative molybdenum utilization protein ModD
The gene modD for a member of this family is found with molybdenum transport genes modABC in Rhodobacter capsulatus. However, disruption of modD causes only a 4-fold (rather than 500-fold for modA, modB, modC) change in the external molybdenum concentration required to suppress an alternative nitrogenase. ModD proteins are highly similar to nicotinate-nucleotide pyrophosphorylase (also called quinolinate phosphoribosyltransferase). The function unknown. [Unknown function, General]
Statistics
?
PSSM-Id: 130401
View PSSM: TIGR01334
Aligned: 3 rows
Threshold Bit Score: 490.183
Threshold Setting Gi: 6478238
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6478238    12 LPISTGLIENLWMEDAGYGDLTTRSLGIQDHPAHITFTARDEQIASSVEEAAALLKQLGASIDYAIPSGSRALSGTLLLE 91
gi 492130173   2 LYFSDNELDDFLLEDIYRGDLTTHALGLESIPAEICFKRKNAGIVAGISIAEKLLRKLDIHPQVYVKEGEFVEAGSLLLS 81
gi 446498984   2 IFLSQAQIDALLLEDIQGGDLTTRALNIGHQHGYIEFFLRQGGCVSGVSVACKMLTTLGLTIDDAVSDGSQANAGQRLIR 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6478238    92 AKASAGQLHLGWKSAQSLMEWSAGIATMTHKMVTLAKKISPMAVVGCTRKAPPLTRPLAVKAVLAGGGVMHRINLSETLL 171
gi 492130173  82 AKGSADKLHQAWKVVQLVLEWSCGVAQYTAEMISNAKAINPAAVVACTRKSIPNTRKLATNAVLAAGGHIHRQGLSETLL 161
gi 446498984  82 AQGNAAALHQGWKAIQNVLEWSCGVSDYLDQMLALLRERYPDGNIACTRKAIPGTRLLASQAILAAGGLIHRAGCAETIL 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6478238   172 VFAEHLTFMN--FDIGKAIGRLKQTAPERKITVEVETIEQALTVAQFSPDILQLEKFTPQQLHHLHERLKFFDHIPSLAA 249
gi 492130173 162 VFTNHRNLLSdpEDWQGIVTRLKQQAPENKITLEADNLVQFEQMLTADPDIIQLDKFTLEQVKQALHLLALANKNITLSV 241
gi 446498984 162 LFANHRHFLHdnQDWSGAINQLRRHAPEKKIVVEADTPKEAIAALRAQPDVLQLDKFSPQQATEIAQIAPSLAPHCTLAL 241
                        250       260       270
                 ....*....|....*....|....*....|....*..
gi 6478238   250 AGGINPENIADYIEAGADIIVTSAPYYAKPCDVQVKL 286
gi 492130173 242 AGGVNKHNVAEYAKLGIQLFITSAPYYAAPEDIKVII 278
gi 446498984 242 TGGINLTTLKNYLDCGIRLFITSAPYYAAPADIKVSL 278
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap