1JB0


Conserved Protein Domain Family
psaA

?
TIGR01335: psaA 
Click on image for an interactive view with Cn3D
photosystem I core protein PsaA
The core proteins of photosystem I are PsaA and PsaB, homologous integral membrane proteins that form a heterodimer. The heterodimer binds the electron-donating chlorophyll dimer P700, as well as chlorophyll, phylloquinone, and 4FE-4S electron acceptors. This model describes PsaA only. [Energy metabolism, Photosynthesis]
Statistics
?
PSSM-Id: 130402
View PSSM: TIGR01335
Aligned: 4 rows
Threshold Bit Score: 1472.88
Threshold Setting Gi: 6685788
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1JB0_A        1 MTISPPEREPK-VRVVVDNDPVPTSFEKWAKPGHFDRTLARGPQTTTWIWNLHALAHDFDTHTSDLEDISRKIFSAHFGH 79
gi 3914447    1 MTISPPEREEKkARVIVDNDPVPTSFELWAKPGHFDRTLARGPKTTTWIWNLHALAHDFDTHTSDLEDISRKIFAAHFGH 80
gi 6685788    1 MIIRSPEPe---VKILVDRDPIKTSFEEWAKPGHFSRTIAKGPDTTTWIWNLHADAHDFDSHTSDLEEISRKVFSAHFGQ 77
gi 14195053   1 MNQILKEKEQKtAKILVDRNPVPTSFEKWGVPGHFSRSLAKGPKTTTWIWNLHADVHDFDSHTSSLEDISRKIFSAHFGQ 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1JB0_A       80 LAVVFIWLSGMYFHGAKFSNYEAWLADPTGIKPSAQVVWPIVGQGILNGDVGGGFHGIQITSGLFQLWRASGITNEFQLY 159
gi 3914447   81 LAVVTLWLSGMIFHGARFSNYEAWLSDPLHVKPSAQVVWPIVGQDILNGDVGGGFHGIQITSGLFQIWRGWGITNSFQLY 160
gi 6685788   78 LSIIFLWLSGMYFHGARFSNYEAWLSDPTHIGPSAQVVWPIVGQEILNGDVGGGFRGIQITSGFFQIWRASGITSELQLY 157
gi 14195053  81 LSLIFIWLSGMYFHGARFSNYTIWLSNPSLIKPSAQIVWPIVGQEILNADLGGGSQGIQITSGFFHLWRASGITNELELY 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1JB0_A      160 CTAIGGLVMAGLMLFAGWFHYHKRAPKLEWFQNVESMLNHHLAGLLGLGSLAWAGHQIHVSLPINKLLDAGVAAKDIPLP 239
gi 3914447  161 VTAIGGLVLAGLFLFAGWFHYHKRAPKLEWFQNVESMLNHHLAVLLGCGSLGWAGHLIHVSAPTNKLLDAGVSVKDIPLP 240
gi 6685788  158 CTAIGALVFAALMLFAGWFHYHKAAPKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLPINQFLNAGVDPKEIPLP 237
gi 14195053 161 VTALGGLFMAGLMAFGGWFHYHKAAPKLEWFQNVESMLNHHLAGLLGLGSLSWAGHQIHVSLPINKLLDAGVDPKTIPLP 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1JB0_A      240 HEFILNPSLMAELYPkvdwGFFSGVIPFFTFNWAAYSDFLTFNGGLNPVTGGLWLSDTAHHHLAIAVLFIIAGHMYRTNW 319
gi 3914447  241 HEFILNKGLLTELYP----GFASGITPFFTLNWGQYADFLTFKGGLNPVTGGLWLTDISHHHLAIAVLFIIAGHMYRTNW 316
gi 6685788  238 HEFILNRDLLAQLYP----SFAEGATPFFTLNWSKYSEFLTFRGGLDPVTGGLWLTDIAHHHLAIAILFLIAGHMYRTNW 313
gi 14195053 241 HEFILNRELMSQLYP----SFEKGLWPFFSLNWGAYSDFLTFRGGLNPITGSLWMSDIAHHHLAISVLFIVAGHMYRTNW 316
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1JB0_A      320 GIGHSLKEILEAHKGPFTGAGHKGLYEVLTTSWHAQLAINLAMMGSLSIIVAQHMYAMPPYPYLATDYPTQLSLFTHHMW 399
gi 3914447  317 GIGHSIKEILENHKGPFTGEGHKGLYENMTTSWHAQLATNLAFLGSLTIIVAHHMYAMPPYPYLATDYATQLCIFTHHMW 396
gi 6685788  314 GIGHGIKDILEAHKGPFTGQGHKGLYEILTTSWHAQLSLNLAMLGSLTIIVAHHMYSMPPYPYLATDYATQLSLFTHHMW 393
gi 14195053 317 GIGHSIKEILDAHRGPLTGSGHRGLYEALTTSWHANLAINLALFGSLSIIVAHHMYAMPPYPYISIDYPTQLSLFTHHTW 396
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1JB0_A      400 IGGFLVVGGAAHGAIFMVRDYDPAMNQNNVLDRVLRHRDAIISHLNWVCIFLGFHSFGLYVHNDTMRAFGRPQDMFSDTG 479
gi 3914447  397 IGGFLIVGGAAHATIFMVRDYDPVVNQNNVLDRVIRHRDAIISHLNWVCIFLGFHSFGLYVHNDTMRALGRPQDMFSDTA 476
gi 6685788  394 IGGFLIVGAAAHAAIFMVRDYDPTNRYNDLLDRVLRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTA 473
gi 14195053 397 IGGFCIVGASAHGAIFMIRDYVPSQHYNNVLDRLIRHRDALISHLNWVCIFLGTHSFGLYIHNDTMRALGRSQDMFSDTA 476
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1JB0_A      480 IQLQPVFAQWVQNLHTLAPGGTAPNAAATASVAFGG-DVVAVGGKVAMMPIVLGTADFMVHHIHAFTIHVTVLILLKGVL 558
gi 3914447  477 IQLQPVFAQWVQNIHTLAPGSTAPNALEPASYAFGG-GIVAVGGKVAMMPIALGTADFLVHHIHAFTIHVTVLILLKGFL 555
gi 6685788  474 IQLQPVFAQWIQNTHALAPGVTAPGETASTSLTWGGgELVAVGGKVALLPIPLGTADFLVHHIHAFTIHVTVLILLKGVL 553
gi 14195053 477 IQLQPIFAQWIQSLHTLAPANTAPNALATTSYVFGG-EVVAVANKIAMMPMKLGTADFMVHHIHAFTIHVTLLILLKGVL 555
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1JB0_A      559 FARSSRLIPDKANLGFRFPCDGPGRGGTCQVSGWDHVFLGLFWMYNCISVVIFHFSWKMQSDVWGTVAPDGTVSHITGGN 638
gi 3914447  556 FARNSRLIPDKANLGFRFPCDGPGRGGTCQVSGWDHVFLGLFWMYNSISIVIFHFSWKMQSDVWGTVDAAGNVTHITGGN 635
gi 6685788  554 FARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDHVFLGLFWMYNAISVVIFHFSWKMQSDVWGSISDQGVVTHITGGN 633
gi 14195053 556 FARNSRLIPDKANLGFRFPCDGPGRGGTCQVSSWDHVFLGLFWMYNCISVVIFHFSWKMQSDVWGTVSQNSLVSHVVGGN 635
                       650       660       670       680       690       700       710       720
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1JB0_A      639 FAQSAITINGWLRDFLWAQASQVIGSYGSALSAYGLLFLGAHFIWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPAIQ 718
gi 3914447  636 WAQSALTINGWLRDFLWAQSVQVINSYGSALSAYGLMFLGAHFIWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPAIQ 715
gi 6685788  634 FAQSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPATQ 713
gi 14195053 636 FSQSAITINGWLRDFLWAQASQVIQSYGSSISAYGLMFLAAHFIWAFSLMFLFSGRGYWQELIESIVWAHSKLKIAPTIQ 715
                       730       740       750
                ....*....|....*....|....*....|....*..
1JB0_A      719 PRALSIIQGRAVGVAHYLLGGIATTWAFFLARIISVG 755
gi 3914447  716 PRALSIIQGRAVGVAHYLLGGIATTWAFFHAHILSLG 752
gi 6685788  714 PRALSIIQGRAVGVTHYLLGGIATTWAFFLARIIAVG 750
gi 14195053 716 PRALSITQGRAVGAAHYLLGGIATTWAFFLSRAISIG 752
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap