2BV8


Conserved Protein Domain Family
phycocy_alpha

?
TIGR01338: phycocy_alpha 
Click on image for an interactive view with Cn3D
phycocyanin, alpha subunit
This model describes the phycocyanin alpha subunit. Other, homologous phyobiliproteins of the phycobilisome include phycocyanin alpha chain and the allophycocyanin and phycoerythrin alpha and beta chains. This model excludes the closely related phycoerythrocyanin alpha subunit. [Energy metabolism, Photosynthesis]
Statistics
?
PSSM-Id: 130405
View PSSM: TIGR01338
Aligned: 4 rows
Threshold Bit Score: 265.272
Threshold Setting Gi: 43386
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2BV8_A       2 KTPITEAIASADSQGRFLSNGELQSINGRYQRATASLEAARSLTSNAERLISGAAQSVYSKFPYTtQMQGPNYAADATGK 81
gi 43386     2 KTPLTEAVAAAHSQGAFLSSTEIQTAFGRFRQASASLAAAKALTEKASSLASGAANAVYSKFPYT-SQNGPNFASTQTGK 80
gi 1346714   2 KTPITEAIATADNQGRFLSNSELHASFGRFQRAASALEAARSLTSNSQKLIDGAAAAVYQKFPYTtQTFGPQYASTAEGK 81
gi 130021    2 KTPITEAIACADSQGRFLSNGELQSINGRYQRATASLEAAKSLNNNAQRLITGAAQAVYTKFPFVtQMPGPTYASRAIGK 81
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2BV8_A      82 AKCARDIGYYLRMVTYcLVVGATGPMDEYLIAGLSEINRSFELSPSWYIEALEYIKDSHALSGQAANEANTYLDYAINAL 161
gi 43386    81 DKCVRDIGYYLRMVTY-CLVGGTGPLDDYLIGGIAEINRTFDLSPSWYVEALKYIKANHGLSGDPAVEANSYIDYAINAL 159
gi 1346714  82 AKCTRDIGYYLRIVTYaLVAGGTGPLDEYLVAGLEEMNRAFDLSPSWYVEALKYIKANHGLSGQAATEANGYFDYVINAL 161
gi 130021   82 AKCARDIGYYLRMTTYcLVVGATGPMDEYLVAGLEEINRSFELSPSWYIEALEYIKNTHGLSGQAANEANTYLDYAINIL 161

               .
2BV8_A     162 S 162
gi 43386   160 S 160
gi 1346714 162 S 162
gi 130021  162 S 162
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap