Conserved Protein Domain Family
acon_putative

?
TIGR01342: acon_putative 
aconitate hydratase, putative, Aquifex type
This model represents a small family of proteins homologous (and likely functionally equivalent to) aconitase 1. Members are found, so far in the anaerobe Clostridium acetobutylicum, in the microaerophilic, early-branching bacterium Aquifex aeolicus, and in the halophilic archaeon Halobacterium sp. NRC-1. No member is experimentally characterized. [Energy metabolism, TCA cycle]
Statistics
?
PSSM-Id: 130409
View PSSM: TIGR01342
Aligned: 2 rows
Threshold Bit Score: 1231.77
Threshold Setting Gi: 15791316
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499183619   5 TVAWKIIKNHLVSGKMEPGEEIAIKIDQTLTQDATGTMCYLEFEAMGVPEVKTELSVSYIDHNMLQTDFRNADDHKYLMS 84
gi 499206382   4 TLTEKILDDHLVEGDLQPGEEIGIEIDQTLSQDTTGTMVWLQFEALEMDEVQTELAAQYCDHQTYQFDFKNTDDHRFLRS 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499183619  85 VAKKFGIWLSKPGNGICHQVHLERFAKPGKTLLGSDSHTPTAGGMGMLAIGAGGLDVAAAMAGEPFYLKMPKIVGVHLKG 164
gi 499206382  84 AAGTYGAYFSRPGNGICHNVHKENFAAPGKTLLGSDSHTPTPGGLGQLAIGAGGIDIAVAMGGGAYYVEMPEVVNVRLEG 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499183619 165 KMPEWVTAKDIILELLRRLTVKGGLGKIFEYFGEGVKELSVPERATITNMGAELGATTSIFPSDEITRAYLRAQGREEDW 244
gi 499206382 164 ELPEWATAKDVILELLRRLSVKGGVGKVLEYTGPGVESLSVPERTTITNMGTELGATSSIFPTDDRTEDWLARFDREDEF 243
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499183619 245 VELLPDPDAEYDEVIEINLSELEPLIAQPHSPDNVVPVREIEGIKVDQVVIGSCTNSSFVDLTRAAKLLEGRRVHPDVVF 324
gi 499206382 244 VDLQADADAEYADEIVVDLSDLEPLIAEPSMPDNVVPVREVAGQEVEQVMVGSCTNGAYEDVLPAAKMLEGREVSKHTEM 323
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499183619 325 AVAPGSKQALELITQNGALLNFLKAGARILESACGPCIGMGFAPPTNGVSVRSFNRNFKGRAGTPDAKVYLASPETCVAA 404
gi 499206382 324 IVAPGSKQASEMLAREGWTAEMMAAGVNFSEATCGACIGIGHVPASDSVSLRTFNRNFEGRSGIEDDSVYLCSPEVATAS 403
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499183619 405 AIAGEIIDPRKLAEREG-VKWIRVEMPEKFPYG-DEAFIPPLPKEEREKVEIYRGPNIKPLPEFEPLPETIEGEVALIVE 482
gi 499206382 404 AIAGEIVDPRDLSDDLGdLEAPGFEMGTSYSGGyGAGDTDIITPEESIDDDLIKGPNISSVPVKDPLGADVRGETLLKMQ 483
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499183619 483 DNITTDHIMPAGAKILPLRSNIYAISEYVYHYVDPEFVPRMKKLKEkgkaGIIIGGENYGQGSSREHAALAPRFLGVRAV 562
gi 499206382 484 DNITTDHIIPATSDILKFRSNIERLSEFTLSRIDDTFAERAKAADS----GVLVAGENYGQGSSREHAAMCPMFLGVESV 559
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 499183619 563 IAKSFARIHHANLVNFGVVPLEFKnKEDYDKFSLGDEIEIPN-LIERLKKGEDILVINKTTGEEILCTYNLTPVQKEILI 641
gi 499206382 560 LAQSFARIHKANLFNFGILPLNID-EETYARIEQGDDVEVVDdVAAAVADGQEEFTVRVNDDWEATATLDASERERRTLA 638
                        650
                 ....*....|....*...
gi 499183619 642 AGGRLNYIKNKHRKEVSA 659
gi 499206382 639 AGGKLSLTKQRHSEGSGA 656
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap