Conserved Protein Domain Family
DAHP_synth_II

?
TIGR01358: DAHP_synth_II 
3-deoxy-7-phosphoheptulonate synthase, class II
This model represents the class II family of 3-deoxy-7-phosphoheptulonate synthase, aka phospho-2-dehydro-3-deoxyheptonate aldolase, as found in plants and some bacteria. It shows some similarity to the class I family found in many bacteria. The enzyme catalyzes the first of 7 steps in the biosynthesis of chorismate, that last common precursor of all three aromatic amino acids. Homologs scoring between trusted and noise cutoff include proteins involved in antibiotic biosynthesis; one example is active as this enzyme, while another acts on an amino analog. [Amino acid biosynthesis, Aromatic amino acid family]
Statistics
?
PSSM-Id: 130425
View PSSM: TIGR01358
Aligned: 6 rows
Threshold Bit Score: 792.812
Threshold Setting Gi: 15841668
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4490619    36 WTPGSWRSRPAAQQP-EWPDPGELRGVEDTLALRPPLVLPDEILDLRRSLAQVAAGEGFLLQAGDCAERFGSCTEAGVRG 114
gi 13172310   30 WSPQSWRQRTALQMP-TYPDAAALEHTLDELRQLPPLVTSWEIFALKRQLAEAQEGKRFLLQGGDCAENFSDCESGTISN 108
gi 12644359   10 SAGNTWRDLPAAQQP-EYPDTEALRAVIADLESYPPLVFAGECDQLRARMAAVAKGEAFLLQGGDCAEAFDAVSADHIRN 88
gi 21264400   52 WSLESWKSKKALQLP-DYPDQKDVDSVLQTLSSFPPIVFAGEARKLEDKLGQAAMGQAFMLQGGDCAESFKEFNANNIRD 130
gi 499222619   5 WTPAAWRAKPAKHLPtDYPDMGAVERVEQTLRQMPPLVFAGEARRLKSQLGEVAEGRAFLLQGGDCAESFKEFHADNIRD 84
gi 490015019  24 TRLDAALAKPAAQQP-TWP-ADRALAMRTVLESVPPVTVPSEIVRLQEQLAQVAKGEAFLLQGGDCAETFMDNTEPHIRG 101
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4490619   115 KLRVILQVAILLTYGSGLPVVKVGRIAGQFGKPRSRPTEAVDGVELPVYRGDIVNGPEFTAEARRPDAGRLLSAYHHASA 194
gi 13172310  109 RLKVLLQMSLVLVHGLRLPVVRVGRFAGQYAKPRSADTETRDGVTLPSYRGDVINAPAFTEAARVPDPRRMITAHSRSAM 188
gi 12644359   89 KLKTLLQMGAVLTYAASVPVVKVGRIAGQYSKPRSKPTETRDGVTLPTYRGDSVNGFDFTEAARIPDPERLKRMYHASAS 168
gi 21264400  131 TFRVLLQMGVVLMFGGQLPVIKVGRMAGQFAKPRSDPFEEKDGVKLPSYRGDNINGDAFDEKSRIPDPHRMVRAYTQSVA 210
gi 499222619  85 TFRLILQMAVVLTFAGGKPVVKVGRIAGQFAKPRSEPIEVQGDVTLPSYRGDIINGMDFNEAERVPDPDRLLKAYGQSAA 164
gi 490015019 102 NVRALLQMAVVLTYGASMPVVKVARIAGQYAKPRSADIDALG---LRSYRGDMINGFAPDAAAREHDPSRLVRAYANASA 178
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4490619   195 ALNVLRALTLGGYADLGQVHEWNQEFVRRSPAGQRYEKAADDITWALRFMSACGLDTRSqaALHQVQLYTSHEALLPQYE 274
gi 13172310  189 TMNFVRALIDGGFADLHHPEYWNLQWVGYSPLAADYQKMVSSIGDAVRFMETLSGAEVY--NLNRIDFYTSHEALLLPYE 266
gi 12644359  169 TLNLVRAFTTGGYADLRQVHAWNQDFVKSSPSGQRYEQLAREIDNALNFMRACGTDPAE---FQTVEFFSSHEALLLDYE 245
gi 21264400  211 TLNLLRAFATGGYAAMQRVSQWNLDFTQHSEQGDRYRELANRVDEALGFMGAAGLTSAHp-IMTTTEFWTSHECLLLPYE 289
gi 499222619 165 TLNLLRAFASGGYADLYNIHRWTLGFVGDSPQGARYRELSEKISEALTFMSAVGVTPDTqpDLRRVEFFTSHEALLLGFE 244
gi 490015019 179 AMNLVRALTSSGLASLHLVHDWNREFVRTSPAGARYEALATEIDRGLRFMSACGVADRN---LQTAEIYASHEALVLDYE 255
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4490619   275 QALIRYDE---KRRGWFDTSAHLLWIGDRTRRVDGAHVELLAGVDNPVGVKVGPTMGVDDLRELCERLDPDRAPGRLVLI 351
gi 13172310  267 EGLTRQVP---RQWGWFNLSTHYPWIGMRTRQLDGAHVEYLRGVRNPIAIKVGPSVQPDQLLRLMDVLNPEDEPGRLSFI 343
gi 12644359  246 SALTRVDS---RTGQLYDVSGHMVWIGERTRQLDHAHIEFASRIRNPIGIKLGPSTTAEEALQYIERLDPEREPGRLTFI 322
gi 21264400  290 QALTREDS---TSGLYYDCSAHMLWVGERTRQLDGAHVEFLRGIANPLGIKVSDKMVPSELVKLIEILNPQNKPGRITVI 366
gi 499222619 245 EAMTRVDS---TSGDWYDTSAHLLWIGERTRQLDGAHVEFMRGVKNPIGLKCGPTMEGDDLLRLIDVLNPHNEPGRLTLY 321
gi 490015019 256 RAMLRLSDgedGEPQLFDLSAHTVWIGERTRQIDGAHIAFAQVIANPVGVKLGPNMTPELAVEYVERLDPHNKPGRLTLV 335
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4490619   352 SRLGAGRGAELLPPLLRAVRDAGHAPVWACDPMHGNTFVSASGYKTRRLSDITTEVAEFFAVHREEGLHPGGIHLELTGD 431
gi 13172310  344 HRMGAAQIAEKLPPLLDAVKRDGRRVLWVCDAMHGNTESTGNGYKTRRFDNIRSEVELSFDLHAAAGTRLGGVHLELTGE 423
gi 12644359  323 VRMGADKIRDKLPELVEKVTASGATVAWITDPMHGNTYEAASGHKTRRFDDVLDEVKGFFEVHKSLGTHPGGIHVELTGD 402
gi 21264400  367 VRMGAENMRVKLPNLIRAVRGAGQIVTWVSDPMHGNTIMAPGGLKTRSFDAIRAELRAFFDVHDQEGSFPGGVHLEMTGQ 446
gi 499222619 322 GRFGSDKIADRLPRLMKATKSAGRSVVWATDPMHGNTLKASTGYKTRPFDRILSEVKSFVEIAQAEGVHPGGVHLEMTGQ 401
gi 490015019 336 SRMGNHKVRDLLPPIVEKVQATGHQVIWQCDPMHGNTHESSTGFKTRHFDRIVDEVQGFFEVHRALGTHPGGIHVEITGE 415
                        410       420       430       440       450
                 ....*....|....*....|....*....|....*....|....*....|
gi 4490619   432 DVTECLGGdLDEVLDTHLASRYETACDPRLNAAQSIELAFGVARLLRELR 481
gi 13172310  424 DVTECTGG-ARELTERDLERAYRSSVDPRLNYEQSLEIAMAIVRKQQQVA 472
gi 12644359  403 DVTECVGG-GDEIFVDDLHQRYETACDPRLNRSQSLDLAFLVAEMYRDQ- 450
gi 21264400  447 NVTECVGG-SRTITYNDLSSRYHTHCDPRLNASQSLELAFIIAERLRKRR 495
gi 499222619 402 NVTECLGG-ARAVSETDLADRYHTHCDPRLNGEQALELAFLVAEKLKAAR 450
gi 490015019 416 NVTECLGG-AQDISETDLAGRYETACDPRLNTQQSLELAFLVAEMLRD-- 462
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap