1FWN,1O60


Conserved Protein Domain Family
KDO8P_synth

?
TIGR01362: KDO8P_synth 
Click on image for an interactive view with Cn3D
3-deoxy-8-phosphooctulonate synthase
This model describes 3-deoxy-8-phosphooctulonate synthase. Alternate names include 2-dehydro-3-deoxyphosphooctonate aldolase, 3-deoxy-d-manno-octulosonic acid 8-phosphate and KDO-8 phosphate synthetase. It catalyzes the aldol condensation of phosphoenolpyruvate with D-arabinose 5-phosphate: phosphoenolpyruvate + D-arabinose 5-phosphate + H2O = 2-dehydro-3-deoxy-D-octonate 8-phosphate + phosphate In Gram-negative bacteria, this is the first step in the biosynthesis of 3-deoxy-D-manno-octulosonate, part of the oligosaccharide core of lipopolysaccharide. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
Statistics
?
PSSM-Id: 130429
View PSSM: TIGR01362
Aligned: 11 rows
Threshold Bit Score: 431.399
Threshold Setting Gi: 16125678
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1FWN_A         2 EKFLVIAGPCAIESEELLLKVGEEIKRLSEK--FkEVEFVFKSSFDKANRSSIHSFRGHGLEYGVKALRKVKEEFGLKIT 79
gi 6647572    16 LQFVLIAGPCQIEGKDHALFMAEKLMKLTSK--L-SIPFIYKSSFDKANRTSINGIRGLGIEKGLEILSKVKSEFDCPII 92
gi 2498499     9 PKSVLIAGPCVIESLENLRSIATKLQPLANn--E-RLDFYFKASFDKANRTSLESYRGPGLEKGLEMLQTIKEEFGYKIL 85
gi 6647545     2 EKFLVIAGPCAIESEELLLKVGEEIKRLSEKf-K-EVEFVFKSSFDKANRSSIHSFRGHGLEYGVKALRKVKEEFGLKIT 79
gi 6647547    19 KPFTLFGGMNVLESRDMAMRVCEQYVEVTNK--L-GVPYVFKASFDKANRSSIHSYRGPGMEEGLKIFQELKDTFGVSII 95
gi 499196255  12 QPLFLIAGPCVIESLQLQLDTAGVLKEITSK--L-GLNFIFKSSFDKANRTSGSSFRGPGLEEGLKVLEAVKTQIGVPVL 88
gi 6647535    15 DPFFLLAGPNVIESEEHIMRMAKHIKTISSK--F-GIPLIFKSSFDKANRTSSKSFRGPGIVEGLKILEKVKIAYDIPIV 91
gi 499185819   4 NKMILIAGPCVIEGEDITLEIAGKLQSILAPysD-RIQWFFKSSYDKANRSSLNSFRGPGLTEGLRILAKVKETFGVGIL 82
gi 492526121  15 DSFFLMAGPCAIESEDMALRIAERIVEVTSR--L-GIPYIFKGSYRKANRSRIDSFTGIGDEKALRILGKVGREFGVPTV 91
gi 499221765  29 EKLSIIAGPCQMESRQHALETAHALKEMADR--L-GVGLIYKTSYDKANRTSANAQRGIGLKDSLAIFQEIREVTGLPTL 105
1O60_A        17 KPFVLFGGXNVLESRDXAXQVCEAYVKVTEK--L-GVPYVFKASFDKANRSSIHSYRGPGXEEGLKIFQELKDTFGVKII 93
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1FWN_A        80 TDIHESWQAEPVAEVADIIQIPAFLCRQTDLLLAAAKTGRAVNVKKGQFLAPWDTKNVVEKLKFGGA------------- 146
gi 6647572    93 TDVHSESQCIETAKVVDILQIPAFLCRQTDLLKAAAKTGKIVKVKKGQFLAPWDMKNVQKKLEVFGA------------- 159
gi 2498499    86 TDVHESYQASVAAKVADILQIPAFLCRQTDLIVEVSQTNAIVNIKKGQFMNPKDMQYSVLKALKTRDksiqsptyetalk 165
gi 6647545    80 TDIHESWQAEPVAEVADIIQIPAFLCRQTDLLLAAAKTGRAVNVKKGQFLAPWDTKN-VVEKLKFGGa------------ 146
gi 6647547    96 TDVHEIYQCKPVAEVVDIIQLPAFLARQTDLVEAMARTGVVINVKKPQFLSPGQMGNIVEKIAECGN------------- 162
gi 499196255  89 TDVHEYTPIDEVATVVDVLQTPAFLVRQTDFIRNVCAVGKPVNIKKGQFLSPWDMKPVVEKAKSTGN------------- 155
gi 6647535    92 TDVHEASQCEPVGRVADIIQIPAFLCRQTDLLVAAAKTGKIINIKKGQFCAPSVMANSAEKVRLAGN------------- 158
gi 499185819  83 TDVHTPQDAYAAAEVCNILQVPAFLCRQTDLLVATAETGAIVNLKKGQFLSPWDMEGPINKVLSTGN------------- 149
gi 492526121  92 TDIHETHEAAMAAEYVDVLQIPAFLCRQTDLIVAAAYTGRIVNVKKGQFLSGEAMAFVARKCVDSGN------------- 158
gi 499221765 106 TDVHETSHCSIVAEAVDVIQIPAFLCRQTDLLVAAASTGRAINIKKGQFLAPWDMKNVIAKVTGAGN------------- 172
1O60_A        94 TDVHEIYQCQPVADVVDIIQLPAFLARQTDLVEAXAKTGAVINVKKPQFLSPSQXGNIVEKIEECGN------------- 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1FWN_A       147 KEIYLTERGTTFGYNNLVVDFRSLPIM-KQ--W--AKVIYDATHSVQLPG-----GLGDKSGGMREFIFPLIRAAVAVGC 216
gi 6647572   160 KDILFTERGSCFGYNNLVSDMRSLAIMsEL--N--VPVVFDATHSVQQPG-----GRGGSSGGERKYVELLAKAAISVGI 230
gi 2498499   166 NGVWLCERGSSFGYGNLVVDMRSLKIM-RE--F--APVIFDATHSVQMPG-----GANGKSSGDSSFAPILARAAAAVGI 235
gi 6647545   147 KEIYLTERGTTFGYNNLVVDFRSLPIM-KQ--W--AKVIYDATHSVQLPG-----GLGDKSGGMREFIFPLIRAAVAVGC 216
gi 6647547   163 ENVILCDRGTNFGYDNLVVDMLGFNIMkKV--SkgCPVIFDVTHSLQCRD-----PFGAASGGRRDQVTELARSGMAIGL 235
gi 499196255 156 SQILVCERGASFGYNNLVSDMRSLAVMrET--G--CPVVFDATHSVQLPG-----AQGGRSGGQREFVPVLARAAVAVGI 226
gi 6647535   159 PNVMVCERGTMFGYNDLIVDPRNLEWMrEA--N--CPVVADITHSLQQPAgkkldGGGVASGGLRELIPCIARTSVAVGV 234
gi 499185819 150 NKILLTERGCSFGYNNLVSDMRSIPVLsRS--G--FPVIFDATHSVQLPG-----ALSTESGGLTEFVPTLSRAALAAGA 220
gi 492526121 159 SQVILTERGNTFGYTDLVVDYRNIPAMrSL--G--FPVVMDVTHSLQQPN-----QGSGVTGGKPELIETIAKAAIAVGA 229
gi 499221765 173 PNVMACERGASFGYNTLVSDMRALPIMkEI--G--CPVVFDATHSVQQPG-----GQGTSSGGQREFVPTLARAAVAVGV 243
1O60_A       161 DKIILCDRGTNFGYDNLIVDXLGFSVXkKAskG--SPVIFDVTHSLQCRD-----PFGAASSGRRAQVTELARSGLAVGI 233
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|...
1FWN_A       217 DGVFMETHPEPEKALSDASTQLPLSQLEGIIEAILEIREVASK 259
gi 6647572   231 AGIYMEVHQDPDNAPSDGPCMIKLDNLESILIKLKKYDKITKE 273
gi 2498499   236 DGLFAETHVDPKNALSDGANMLKPDELEQLVTDMLKIQNLF-- 276
gi 6647545   217 DGVFMETHPEPEKALSDASTQLPLSQLEGIIEAILEIREVASK 259
gi 6647547   236 AGLFLEAHPDPNSAKCDGPSALPLSKLEAFVSQMKAIDDLVKS 278
gi 499196255 227 SGLFAETHPDPPNALSDGPNAWPLHTMAMLLETLVELDAVTKK 269
gi 6647535   235 DGIFMEVHDDPLNAPVDGPTQWPLRHLEELLEELIAISRVSKG 277
gi 499185819 221 HGLFIETHTNPKIAKSDAASMLSLEEFAALLPTWDQLFTCVSS 263
gi 492526121 230 DGLFIETHPDPASAKSDGANMLRLDLLEGLLTKLMRIRAAIRD 272
gi 499221765 244 ACVFIETHPDPDNAPSDGPNMVPVKEFEALVANLLRYDALTKA 286
1O60_A       234 AGLFLEAHPNPNQAKCDGPSALPLSALEGFVSQXKAIDDLVKS 276
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap