Conserved Protein Domain Family
serC_2

?
TIGR01365: serC_2 
phosphoserine aminotransferase, Methanosarcina type
This model represents a variant form of the serine biosynthesis enzyme phosphoserine aminotransferase, as found in a small number of distantly related species, including Caulobacter crescentus, Mesorhizobium loti, and the archaeon Methanosarcina barkeri. [Amino acid biosynthesis, Serine family]
Statistics
?
PSSM-Id: 130432
View PSSM: TIGR01365
Aligned: 3 rows
Threshold Bit Score: 725.205
Threshold Setting Gi: 16127446
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1711378     6 VPNNPCFSSGPCAKHPGYSIEELKDTPFGRSHRSNLGKEKLAEAIKKTRDMLGLPDDYLVGIVPASDTGAFEMCLWSMLG 85
gi 499214476  10 RPANPNFSSGPCAKRPGWSVEALKNAALGRSHRAKIGKTKLEQAIELTREILQVPADHRIGIVPASDTGAVEMALWSLLG 89
gi 499223509  11 RPARPEFSSGPCAKRPGWTPENLRNAVLGRSHRSKLGKARLKAAIDQTREVLEVPADFLIGIVAGSDTGAVEMAMWSMLG 90
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1711378    86 CRGVDVLVWESFSKGWATDITKQLKLKDVRVFEAEYGKLPDLKKVDFKNDVVFVWNGTTSGVKVPNGDWIPENREGLTLC 165
gi 499214476  90 ERGVDMVAWESFGSGWVTDVVKQLKLPDVRKLEAGYGELPDLAKIDFDRDVVFTWNGTTSGVRVPNGDFIPADRKGLTIC 169
gi 499223509  91 ARPVQLLAFESFGKDWVTDVTKQLKLPDVEVLSAPYGQLPDTSKVDPAKDLVFTWNGTTSGVRVPNADFISADREGITIC 170
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1711378   166 DATSAIFAMDIPYHKLDVITFSWQKVLGGEGAHGMLILSPRAVQRLESYTPAWPLPKIFRLTK-----GGKLNKKIFEGS 240
gi 499214476 170 DATSAAFAQRLDFEKLDVVTFSWQKVLGGEGAHGMLILSPRAVARLESYKPAWPLPKIFRLTS-----GGKLIEGIFKGE 244
gi 499223509 171 DATSAAFAQDLDWTKLDVVTFSWQKALGGEGAHGVLILSPRAVARLESYTPAWPMPKLFRMTKankdgGNKVSLDIFEGA 250
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1711378   241 TINTPSMLANEDWLATLKWAESVGGLKPLIQRTNDNLAVFEAFVAKNNWIHFLAETKEIRSSTSVCFKV-----DLSDEK 315
gi 499214476 245 TINTPSMLCVEDYLDALHWAKSIGGLDVLVARADANAAVLDGFVDKSSWLGHLAVQPATRSNTSVCLSFtdpdvAALDAD 324
gi 499223509 251 TINTPSMLCVEDALDALKWASSIGGLQAMQARADQNLKVLADWVAKTPWVDFLAATPEIRSNTSVCLKVvdpaiCALPED 330
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|....*....
gi 1711378   316 -----LKELIKTLEKEKVAYDIGSYRDAPSGLRIWCGATVEKEDLQCLCEWIEWAYNLV 369
gi 499214476 325 gqatfAKGLVSALDKEGVAYDIGSYRDAPPGLRIWCGATVETSDLETLLPWLDWAFAAQ 383
gi 499223509 331 aqadfAKKLASLLEKEGAALDIGGYRDAPAGLRIWCGATVEASDLEALTPWLDWAFATV 389
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap