2FYF


Conserved Protein Domain Family
serC_3

?
TIGR01366: serC_3 
Click on image for an interactive view with Cn3D
phosphoserine aminotransferase, putative
This model represents a putative variant form of the serine biosynthesis enzyme phosphoserine aminotransferase, as found in Mycobacterium tuberculosis and related high-GC Gram-positive bacteria. [Amino acid biosynthesis, Serine family]
Statistics
?
PSSM-Id: 130433
View PSSM: TIGR01366
Aligned: 4 rows
Threshold Bit Score: 705.925
Threshold Setting Gi: 12541582
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2FYF_A       38 KPRDGRFGSGPSKVRLEQLQTLTTTAAALFGTSHRQAPVKNLVGRVRSGLAELFSLPDGYEVILGNGGATAFWDAAAFGL 117
gi 1711379   16 KPRDGRFGSGPSKVRLEQLQTLTTTAAALFGTSHRQAPVKNLVGRVRSGLAELFSLPDGYEVILGNGGATAFWDAAAFGL 95
gi 12541582  12 IPGDGRFGCGPSKVRPEQIQAIVDGSASVIGTSHRQPAVKNVVGSIREGLSDLFSLPEGYEIILSLGGATAFWDAATFGL 91
gi 10129767   2 KPADGRFGAGPSKVRVEALDALAATGTSLLGTSHRQAPVKNLVGKVREGIRELFRLPDGYEVILGNGGSTAFWDVATHGL 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2FYF_A      118 IDKRSLHLTYGEFSAKFASAVSKNPFVGEPIIITSDPGSAPEPQTDPSVDVIAWAHNETSTGVAVAVRRPEGSDD-ALVV 196
gi 1711379   96 IDKRSLHLTYGEFSAKFASAVSKNPFVGEPIIITSDPGSAPEPQTDPSVDVIAWAHNETSTGVAVAVRRPEGSDD-ALVV 174
gi 12541582  92 IEKKSGHLSFGEFSSKFAKASKLAPWLDEPEIVTAETGDSPAPQAFEGADVIAWAHNETSTGAMVPVLRPEGSEG-SLVA 170
gi 10129767  82 IENKSQHLSFGEFSSKFAKAAKLAPWLAEPTVVAADPGTHPEARAEAGVDVYGLTHNETSTGVAMPIRRVAGADEgALVL 161
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2FYF_A      197 IDATSGAGGLPVDIAETDAYYFAPQKNFASDGGLWLAIMSPAALSRIEAIAATGRWVPDFLSLPIAVENSLKNQTYNTPA 276
gi 1711379  175 IDATSGAGGLPVDIAETDAYYFAPQKNFASDGGLWLAIMSPAALSRIEAIAATGRWVPDFLSLPIAVENSLKNQTYNTPA 254
gi 12541582 171 IDATSGAGGLPVDIKNSDVYYFSPQKCFASDGGLWLAAMSPAALERIEKINASDRFIPEFLNLQTAVDNSLKNQTYNTPA 250
gi 10129767 162 VDATSGAGGLPVDISETDVYYFAPQKSFASDGGLWIGVFSPAAIERAERVHASGRHVPEFFSLPTAIDNSRKNQTYNTPA 241
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2FYF_A      277 IATLALLAEQIDWLVGNGGLDWAVKRTADSSQRLYSWAQERPYTTPFVTDPGLRSQVVGTIDFVDDVDAGTVAKILRANG 356
gi 1711379  255 IATLALLAEQIDWLVGNGGLDWAVKRTADSSQRLYSWAQERPYTTPFVTDPGLRSQVVGTIDFVDDVDAGTVAKILRANG 334
gi 12541582 251 VATLLMLDNQVKWMNSNGGLDGMVARTTASSSALYNWAEAREEASPYVADAAKRSLVVGTIDFDDSIDAAVIAKILRANG 330
gi 10129767 242 LATLFLLGEQLDWMNGQGGLDFTTARTKDSSSRLYTWADESKYATPFVSDPTKRSQVIGTIDFSDDIDAAAVAKVLRANG 321
                       330       340       350       360
                ....*....|....*....|....*....|....*....|..
2FYF_A      357 IVDTEPYRKLGRNQLRVAMFPAVEPDDVSALTECVDWVVERL 398
gi 1711379  335 IVDTEPYRKLGRNQLRVAMFPAVEPDDVSALTECVDWVVERL 376
gi 12541582 331 ILDTEPYRKLGRNQLRIGMFPAIDSTDVEKLTGAIDFILDGG 372
gi 10129767 322 IVDTEPYRKLGRNQLRVAMFPAIDPADVEALTKCVDHVIEKL 363
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap