1YT3


Conserved Protein Domain Family
rnd

?
TIGR01388: rnd 
Click on image for an interactive view with Cn3D
ribonuclease D
This model describes ribonuclease D, a 3'-exonuclease shown to act on tRNA both in vitro and when overexpressed in vivo. Trusted members of this family are restricted to the Proteobacteria; Aquifex, Mycobacterial, and eukaryotic homologs are not full-length homologs. Ribonuclease D is not essential in E. coli and is deleterious when overexpressed. Its precise biological role is still unknown. [Transcription, RNA processing]
Statistics
?
PSSM-Id: 130455
View PSSM: TIGR01388
Aligned: 7 rows
Threshold Bit Score: 489.281
Threshold Setting Gi: 15837353
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1YT3_A         5 MITTDDALASLCEAVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPLGI-TDWSPLKAILRDPSITKFLHAGS 83
gi 9947230     8 WIRDDASLAQQCREWRTQPYLALDTEFMRVDTFYPAAGLVQVGDGRQEWLIDPLLI-QDWSPFAELLEDERVVKVLHACS 86
gi 133152      5 MITTDDALASLCEAVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPLGI-TDWSPLKAILRDPSITKFLHAGS 83
gi 445991338  13 IISQVGDLQRVCLAARDADVVMLDTEFVRTRTFFPQLGLIQMFDGENLSLIDPTVL-DEMTPFVELLQDTSVLKVLHACG 91
gi 499218015   3 VITTQKELETVLAAFEKSDFVTVDTEFIRETTFWPILCLIQMAAPGVTALIDPLSPdINLAPFFRLMANEAVVKVFHAAR 82
gi 499222033   3 LITTTAELAAFCNGLAGEPFVAVDTEFMRETTYWPKLCLIQVASPTQEAVIDPLADnIDLEPLLVVMRDERILKVFHAAR 82
gi 499195734   4 WIQHPDTLATWWDRKPTR--IGMDTEFIRERTFWPELALVQIAIEDEILLVDPLVP-GMTDALGLWLAAPNVIKIMHSAS 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1YT3_A        84 EDLEVFLNVFGELPQPLIDTQILAAFCGRPMSWGFASMVEEYSGVTLDKSESRTDWLARPLTERQCEYAAADVWYLLPIT 163
gi 9947230    87 EDLEVFLRLTGSLPVPLFDTQLAAAYLGMAHSMGYSKLVKEVLDIDLPKDETRSDWLQRPLTEMQMRYAADDVQHLAQVY 166
gi 133152     84 EDLEVFLNVFGELPQPLIDTQILAAFCGRPMSWGFASMVEEYSGVTLDKSESRTDWLARPLTERQCEYAAADVWYLLPIT 163
gi 445991338  92 EDLEVFQNAFGCTPFPMVDTQIMAAFLGYGLSTGFAALVQDQLQVELDKSESRTDWLARPLSDKQLEYAAADVFYLLPMY 171
gi 499218015  83 QDIEIIVHLGDLVPHPVFDTQVAAMVCGFGDSVSYDQLVQRITGARLDKSSRFTDWRHRPLSDKQLDYALADVTHLIEVY 162
gi 499222033  83 QDVEIFNNL-KAMPKPLFDTQVAGMAAGFGEQIAYDALVRQMLRIEIDKSSRFTDWARRPLTDAQLSYALADVTHLAKLF 161
gi 499195734  81 EDLIAFKYACGVLPRPLFDTQIGAALTGLGGGMGYQKLVATVTNVALEKGETRSDWMHRPLTPAQLDYAANDVRYLFALH 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1YT3_A       164 AKLMVETEASGWLPAALDECRLMQMRrQEVVAPEDAWRDITNAWQLRTRQLACLQLLADWRLRKARERDLAVNFVVREEH 243
gi 9947230   167 LALDTRLSEEKRAWLLEDGAELVANL-CRESDPREAYREVKLGWRLRPQQLAVLRELCAWREEQARLRNRPRNHVLRERT 245
gi 133152    164 AKLMVETEASGWLPAALDECRLMQMRrQEVVAPEDAWRDITNAWQLRTRQLACLQLLADWRLRKARERDLAVNFVVREEH 243
gi 445991338 172 EKLVEQVTQAGWWDAALQESELQVAKrTKVSNPELAYLDIKGAWQLKPKELAILKPLATWRYHEAVNRDLALNFVIKETD 251
gi 499218015 163 QHLSAELARENRAHWLNEEMDVLTSReTYDPHPEDAWKRLK-MRLRKPQELAIVQAVAAWREREARERDVPRGRVLKDDA 241
gi 499222033 162 PILRERLETSGRLAWVEEEMTAISDPaAYDVDPEKAWRRLR-PRKTAPKYLAVFKAVAAWRERTAQNRDQPRGRILKDEA 240
gi 499195734 161 DTLTERLAEMSRSAWLEEDCTRLTDNiEQNENERWPHLAIHSAQLLDAPAQYRLLRLLRWRETSARTRNKPRNWILNNEL 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1YT3_A       244 LWSVARYMPGSLGELDSL--G--LSGSEIRFHGKTLLALVEKAQTLPEDALPQPMLNLMDmP-GYRKAFKAIKSLITDVS 318
gi 9947230   246 LWPLARLLPKNKTDLAAI--Ed-MHPRTVRQDGDFLIELIAQAARLPQSEWPEALPEPLP-P-EVTPLLKSLRAIGQREA 320
gi 133152    244 LWSVARYMPGSLGELDSL--G--LSGSEIRFHGKTLLALVEKAQTLPEDALPQPMLNLMDmP-GYRKAFKAIKSLITDVS 318
gi 445991338 252 LLTISRLALRSPKRMEEE--G--VDPHAIRRHSSKIIAMVKTALETPADAYPPEIVPIMEyP-GYKQLFKRLKDEVKSVS 326
gi 499218015 242 IYEVAQQAPRDAAALAKLrtT--PKGWERSSTATALLGAVNTALALPKEQMPKLPKNFQPpE-GSSAAAELLKVLLRIVA 318
gi 499222033 241 IDELATQTPGNLEALNNL--RgvPKGFGGSKFGPDLLAAIKDALADPEGYAPVVDKPGPPpPqNAGAVVELLKVLLKARA 318
gi 499195734 241 ASILARFPPPNLTELR-------YQLKKFNKSWDPLATQILEALHTPVADEAQAPLATAPsD-ADKALLKQLQKIVAECS 312
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|....*.
1YT3_A       319 ETHKISAELLASRRQINQLLNWHWKlkp-qnNLPELISGWRGE-LMAEALHNLLQE 372
gi 9947230   321 ETLGMAPELMLRKKVLEALLKSGYPdg--pyELPDSLRGWRRErMGQALLDALESA 374
gi 133152    319 ETHKISAELLASRRQINQLLNWHWKlkp-qnNLPELISGWRGE-LMAEALHNLLQE 372
gi 445991338 327 NTSGLATEFLASKKQLNQLLSWVWKrdrdpaRLPDLMQGWRLP-LLGEKLNTLVLK 381
gi 499218015 319 EKQGVASKVLASSDDIDRIAAEGED------ADVPALQGWRRAvFGEAALKLVRGE 368
gi 499222033 319 EEAGVASKLIATVSDLEKIAAD-DN------ATTPALTGWRREaFGSDALKIKRGE 367
gi 499195734 313 YDLGLPEGILASRRHLEALIEQRR--------WPNSLGQWRRS-LLETQLQPLLSM 359
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap