Conserved Protein Domain Family
CycNucDiestase

?
TIGR01390: CycNucDiestase 
2',3'-cyclic-nucleotide 2'-phosphodiesterase
2',3'-cyclic-nucleotide 2'-phosphodiesterase is a bifunctional enzyme localized to the periplasm of Gram-negative bacteria. 2',3'-cyclic-nucleotide 2'-phosphodiesters are intermediates formed during the hydrolysis of RNA by the ribonuclease I, which is also found to the periplasm, and other enzymes of the RNAse T2 family. Bacteria are unable to transport 2',3'-cyclic-nucleotides into the cytoplasm. 2',3'-cyclic-nucleotide 2'-phosphodiesterase contains 2 active sites which catalyze the reactions that convert the 2',3'-cyclic-nucleotide into a 3'-nucleotide, which is then converted into nucleic acid and phosphate. Both final products can be transported into the cytoplasm. Thus, it has been suggested that 2',3'-cyclic-nucleotide 2'-phosphodiesterase has a 'scavenging' function. Experimental evidence indicates that 2',3'-cyclic-nucleotide 2'-phosphodiesterase enables Yersinia enterocolitica O:8 to grow on 2'3'-cAMP as a sole source of carbon and energy (). [Purines, pyrimidines, nucleosides, and nucleotides, Other]
Statistics
?
PSSM-Id: 130457
View PSSM: TIGR01390
Aligned: 4 rows
Threshold Bit Score: 1026.35
Threshold Setting Gi: 15806739
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 729161     22 VDLRIMETTDLHSNMMDFDYYKDTATEKFGLVRTASLINDARNEVKNSVLVDNGDLIQGSPLADYMS-AKGLKAGDIHPV 100
gi 1168981    32 VDLRIVATTDVHSFLTDFDYYKDAPTDKFGFTRAASLIRQARAEVKNSVLVDNGDLIQGNPIADYQA-AQGYKEGKSNPA 110
gi 487821211  56 IKLRIVETTDIHTNLMDYDYYKDKASDQIGLTRAATLVKQARAEVENSVLVDNGDLIQGSPMGDYMA-AKGIKAGEVHPV 134
gi 499190831  64 VDLRILETTDLHTNALGYDYYQDKPTGEFGLEYTATLLKQAREEKRNTLLYDNGDLIQGTPLGDYVArVQPLRAGQMHPL 143
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 729161    101 YKALNTLDYTVGTLGNHEFNYGLDYLKNALAGAKFPYVNAN-VIDARTKQP---MFTPYLIKDTEVVDKDGKKQTLKIGY 176
gi 1168981   111 IDCLNAMNYEVGTLGNHEFNYGLNYLADAIKQAKFPIVNSN-VVKAGTEEP---YFTPYVIQEKSVVDNQGKTHKLKIGY 186
gi 487821211 135 YKAMNPLGYDVGNIGNHEFNYGLEFLKETINDAAFPYINAN-VFDAKTGQH---LFTPYVIKEHSFKDTDGEAHTIKVGY 210
gi 499190831 144 HAAMRLLKYDAANLGNHEFNYGLPFLQQVVAAAPMPIVSANtYVDDGNGKPganAFTPYLIQRRTVYDTEGRPYILNVGV 223
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 729161    177 IGVVPPQIMGWDKANLSGKVTVNDITETVRKYVPEMREKGADVVVVLAHSGLSADPYKVMAENSVYYLSEIPGVNAIMFG 256
gi 1168981   187 IGFVPPQIMVWDKANLQGKVETRDIVKTAQKYVPEMKKKGADIVVALAHTGPSDEPYQEGAENSAFYLADVPHIDAVIFG 266
gi 487821211 211 IGFVPPQIMVWDKKNLEGKVTAADIKQTAEKLIPEMKAKGADVIVAIPHSGISTDEYQAGAENSVYYLTQVKGIDAIAFG 290
gi 499190831 224 IGLLTPQIVQWDKSNLDGKIVTADIVDTARKFVPEMKAAGADIIVAVAHSGINAD-YQPGQENVATELTKVPGIDVVLSG 302
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 729161    257 HAHAVFPGKDFADIEGADIAKGTLNGVPAVMPGMWGDHLGVVDLQLSND--SGKWQVTQAKAEARPIYDIANKKSLAAED 334
gi 1168981   267 HSHRLFPNKEFAKSPNADIVNGTVKGIPESMAGYWANNISVVDLGLTEH--KGKWIVTSGKAVLRPIYDIETKKALAKND 344
gi 487821211 291 HSHAVFPGKDFANVPGADIDKGTINGVTAVMPGRWGSHVGVMDLTLEKQ--QGRWAVTSGQSEARPIFDKANKKALVEAD 368
gi 499190831 303 HSHQEFPGPVYKTIPGADITNGTINGKPVVMAGYWGNDLGVVDLQLNYDrkSQTWTIQNAKTSLRPIWDKTAKKSLVTPD 382
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 729161    335 SKLVETLKADHDATRQFVSKPIGKSADNMYSYLALVQDDPTVQVVNNAQKAYVEHYIQGDPDLAKLPVLSAAAPFKVGGR 414
gi 1168981   345 PEITALLKPVHEATRKYVSQPIGKATDNMYSYLALLQDDPTIQIVNQAQKAYVEKVAPSIAAMAGLPILSAGAPFKAGGR 424
gi 487821211 369 ATMVQALQHDHQGTRDFVNQPIGKANDVMYSFLSLVQDDPTVQIVNLAQKDYVERFIQGDPNLDGLPVLSAAAPFKAGGR 448
gi 499190831 383 PAIARAVKAAHEGTLRYVRGKVADLAAPVTSYWALVQDDPSVQLVSNAQTAYVKAALAS-TQYKDLPVLSAAAPFKAGGR 461
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 729161    415 KNDPASYVEVEKGQLTFRNAADLYLYPNTLIVVKASGKEVKEWLECSAGQFNQIDPNSTKPQSLINWDGFRTYNFDVIDG 494
gi 1168981   425 KNDPTGYTEVNKGKLTFRNAADLYLYPNTLVVVKATGEQLKEWLECSAGMFKQIDPTSDKPQSLIDWEGFRTYNFDVIDG 504
gi 487821211 449 KDDPNGFTEVEAGELTFRNAADLYLYPNTLVTMKVSGQQLKEWLECSAGQFNQIDVTSSAPQSLINWDGFRTYNFDVIDG 528
gi 499190831 462 -GGVSYYTDIPAGTLAIKNVADLYVYPNTVQAVLVTGAQVQEWLERAAGQFKQIDPSKTEPQALVD-DSFPTYNFDILDG 539
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 729161    495 VNYQIDVTQPARYDGECQMINANAERIKNLTFNGKPIDPNAMFLVATNNYRAYGG-KFAGTGDSHIAFASPDENRSVLAA 573
gi 1168981   505 VNYEYDLTKPARYDGECKLINPESHRVVNLTYQGKPVDPKAEFLIATNNYRAYGN-KFPGTGDKHIVYASPDESRQILAD 583
gi 487821211 529 VNYQIDVTQPARYDGDCKLINPNSQRIVQLTYQGKPIDTQQTFLIATNNYRAYSN-KFPGTGAEFVAFDSPDENRTVVAD 607
gi 499190831 540 VTYEIDVTQPSRYGSDGKVANEGAHRIKNLMYGGKPIDPAAQFVVATNNYRASGGgKFPGLDGKNIILQAPDETRQALIA 619
                        570       580       590       600       610       620       630
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 729161    574 WIADESKRAGEIHPAADNNWRLAPIAGDKKLDIRFETSPSDKAAAFIKEKGQYPMNKVATDDIGFAIYQVDLSK 647
gi 1168981   584 YIKATSEKEGSVNPNADKNWRFVPITGNDKLDVRFETSPSEQAAKFIAEKAQYPMKQVGTDEIGFAVYQIDLSK 657
gi 487821211 608 YIARVSKDKGEVTPSADNNWSFAPISSKTKLDIRFETSPSDKATQFIKQKGQYPMTRVASDDVGFAVYRIDLQK 681
gi 499190831 620 YFQDQK----TVNPAADGNWKLTPIPG-VTLSVvsspngqknlpagvtyvqtrddgfaeynlkf---------- 678
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap