Conserved Protein Domain Family
fliM_switch

?
TIGR01397: fliM_switch 
flagellar motor switch protein FliM
Members of this family are the flagellar motor switch protein FliM. The family excludes FliM homologs that lack an N-terminal region critical to interaction with phosphorylated CheY. One set lacking this N-terminal region is found in Rhizobium meliloti, in which the direction of flagellar rotation is not reversible (i.e. the FliM homolog does not act to reverse the motor direction), and in related species. Another is found in Buchnera, an obligate intracellular endosymbiont with genes for many of the components of the flagellar apparatus, but not, apparently, for flagellin iself. [Cellular processes, Chemotaxis and motility]
Statistics
?
PSSM-Id: 130464
View PSSM: TIGR01397
Aligned: 9 rows
Threshold Bit Score: 372.809
Threshold Setting Gi: 221235077
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4322004     3 DLLSQDEIDALLHGVDDVd------DIDEP-L--DNDTEG-AVSFDFSSQDRIVRGRMPTLELINERFARHMRISLFNML 72
gi 120345      4 SILSQAEIDALLNGDSEVk------DEPTA-S--VSGESD-IRPYDPNTQRRVVRERLQALEIINERFARHFRMGLFNLL 73
gi 4426948     3 EVLSQDEIDQLLTAISSGd-----tDTEDFrA--VNDTRK-IKIYDFKRPDKFSKEQMRTVQMMHETFARLTTTSLSAQL 74
gi 2315249     6 RKLSSKEVAALVGNLMEAs------ESTS-----LENGLE-VRPYAFGENELNQLGDYHALRIINERFCRTARDVFLPML 73
gi 499201059   3 DVLSQGEIDALLSALSTGe-----mDADELkK--EELEKK-VKVYDFKRALRFSKDQIRSISRIHENFARLLTTYFSAQL 74
gi 500034391   3 QILSTDEIDALMMGLEEGtidldeiDEDMPsA--SKDEKK-TTPFTFGQKTAIRVGALPGLDLINEHLASQLSFKLTQKV 79
gi 490182470   3 DVLSQEEINQLIEALMKGe------LKEEDlL--KEEEEKkVKPYDFKRPSKFSKEQLRTFQMIHENFGRALSTYLSGRL 74
gi 446686229   3 DILSQEEIDALLEVVDENv------DIQNVqKkdIIPQRS-VTLYDFKRPNRVSKEQLRSFRSIHDKMARNLSSQVSSIM 75
gi 501787109  50 RILNQDEIDSLLGFDLSGd------GSDD----------R-TGIRAIINSALVSYERLPMLEIVFDRLVRLMTTSLRNFT 112
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4322004    73 RKTAEVSINGVQMMKFGEYQNTLYVPTSLNMVRFRPLKGTALITMEARLVFILVENFFGGDGRFHAk-iEGREFTPTERR 151
gi 120345     74 RRSPDITVGAIRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTk-vEGREFTHTEQR 152
gi 4426948    75 RSMAHVHVATVEQLTYEEFIRSIPTPTTLAIINMDPLRASALLEIDPSVTFSIIDRLFGGKGQGSK---VQRELTEIESS 151
gi 2315249    74 RLQPRISSFPPEVRSFDDYRSSQDNFVSITASRIEELRGNQMIVIPPPFISLLTDSYYGGQIRHVPt--TRTEFTATEER 151
gi 499201059  75 RTFVQISVASVDQLPYEEFIRSIPKMTILNVFEPAPLDGRFLIEVNPNVAYAMLDRLLGGQGVSVN---KVDNLTEIETR 151
gi 500034391  80 GREVHVQPKTTTNQVFGRFLHTVEPPIFINILRVEPSQSMALISIDGDVMYTVLEGFFGGPGDSER---PFRNFSPFEMK 156
gi 490182470  75 RTFVDVEI-SIDQLTYEEFIRSVMIPSFIVIFTGDVFEGSAIFEMRLDLFYTMLDIIMGGPGENPP----NRPPTEIETS 149
gi 446686229  76 RSIVEIQLHSVDQMTYGEFLMSLPSPTSFNVFSMKPMGGTGVLEINPSIAFPMIDRLLGGKGSAYD---QNREFSDIELN 152
gi 501787109 113 SDNVEVSLDNISSIRFGDYLNSIPLPAILAVFRAEELDNYGLLTVDSNLIYSIVDVLLGGRRGTAAmriEGRPYTTIERV 192
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4322004   152 IIQLLLKIVFEDYKEAWSPVMG-VEFEYLDSEVNPSMANIVS-PTEVIVVSSFHIEVDGGG-GDFHVVMPYSMVEPIREL 228
gi 120345    153 VINRMLKLALEGYSDAWKAINP-LEVEYVRSEMQVKFTNITTsPNDIVVNTPFHVEIGNLT-GEFNICLPFSMIEPLREL 230
gi 4426948   152 VMEGVIVRILANMREAWTTVVD-LRPRLGNIDTNPQFVQIVT-PSEMVLLVTLETKVGEEE-GMMNICLPYITLEPIISK 228
gi 2315249   152 CIELVTDRLNVALQVAWRDLMA-LTFTVVSREESMQFASFVD-GEDMVVNCSFMVQLPNTEpASFDILYPLQTLKPISSQ 229
gi 499201059 152 IMSQLFQRTLDSFQEAWSTVIE-LEPEMDAVEVNPQFLQMVS-PNETVVVISLSTTIAETS-GMINICLPHVVLEEVLPK 228
gi 500034391 157 VIDRIMDVAREQIELSWKKLDPsFRLVLARWENQPQFAAVMP-LDETVFLITFSVEVGDAE-GNITICFPAVILELFKQQ 234
gi 490182470 150 IMRKEVTNMLTLLAQAWSDFQY-FIPSIENVETNPQFVQIVP-PNEIVLLVTASVSWGEFT-SFINVCWPFSLLEPLLEK 226
gi 446686229 153 LLDTILRQVMQILKEVWSPVVE-MFPTIDAKESSANVVQIVA-QNEISIMVVLEIIIGHSR-GMMNICYPVISIESILSK 229
gi 501787109 193 LVQRMIEVVLHDLKSAFEPLHP-VSFSLDRLETNPRFAAIAR-PANAAILVKLRIDMEDRG-GRIELLLPYATLEPIRKM 269
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4322004   229 LDAG--VQSDKMETDVRWSSALREEIMDCPVNFRVNLLEKDISLRDLMELQPGDIIPIE---MPEHATMFIEDLPTYRVK 303
gi 120345    231 LVNP--PLENSRNEDQNWRDNLVRQVQHSQLELVANFADISLRLSQILKLNPGDVLPIE---KPDRIIAHVDGVPVLTSQ 305
gi 4426948   229 LSTQfwFSSVRRASTGQYAAAIKDKLSTVEVDMVAEVGSLDVSIRDVLNLRAGDVVRLPnvrVGDPFKLTVGSRPKFSCQ 308
gi 2315249   230 LRSR--MQSDFVDDDRSWREKLERAILSIPLTLSARLCEPEVPLRQLMQMQPGDVLPVH---LTEALSLLVEGQPIFEAA 304
gi 499201059 229 LSVHywMQEKKKQRQPGELDSIEHRVRQAPLLIQTELGRSEITIHEFLHLGIGDVIELDq-sIHEPLNVRVGGHLKYLAQ 307
gi 500034391 235 LKQGf-QQKEEVEGASAWMDALKNELSLVRVDMTPVMGTVEMSVEQMLNLKVGDEFILGt-dMSEEMAVQIGGMDKFMCH 312
gi 490182470 227 LSDRfwMMGRKPEKVEERMEELRKASQKIPVTVQAVIGETELRLKEILDLEVGDVIRLGt-hYKDEIRIDVEGRPKFRGI 305
gi 446686229 230 MGSRdlMLSETNSKKS-RNKELQALLSGVSVDMIVFLGAVELSLKEMLDLDVGDTIRLNk-iANDEVSVYVHKKKRYLAS 307
gi 501787109 270 LLQQf-M-GEKFGRDNIWEGHLATELWTTQMEVRAVLDEQQVPLSRVLNMQVGDTLMLNa-tPDSLVELRAGAIPLTRGR 346
                        330
                 ....*....|....*..
gi 4322004   304 MGRSEDKLAVQVSQEIE 320
gi 120345    306 YGTLNGQYALRIEHLIN 322
gi 4426948   309 PGVKGKKLAVQILEKIE 325
gi 2315249   305 PGERGGQAALNLTRRHV 321
gi 499201059 308 PGKKKNHLAVQVTDVIE 324
gi 500034391 313 AGVVDGKRAIRITRTVQ 329
gi 490182470 306 PGVFKGKYAVKVTGEFT 322
gi 446686229 308 VGFQGYRKTIQIKEVIY 324
gi 501787109 347 MGRRNHSIAVRAEAPLT 363
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap