Conserved Protein Domain Family
fliR_like_III

?
TIGR01401: fliR_like_III 
type III secretion protein SpaR/YscT/HrcT
This model represents members of bacterial type III secretion systems homologous to the flagellar biosynthetic protein FliR (TIGRFAMs:TIGR01400). [Protein fate, Protein and peptide secretion and trafficking, Cellular processes, Pathogenesis]
Statistics
?
PSSM-Id: 130468
View PSSM: TIGR01401
Aligned: 11 rows
Threshold Bit Score: 212.906
Threshold Setting Gi: 49082920
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 818893      5 AHSAFQFMLGMGLAMARLMP------CMLLVPAFCFKYLKG-PLRYAVVAVMAMIPAPAITRALESLDDNw--FAIGGLL 75
gi 10189622    7 FVEAKVFLGTLAMTQPRILT------AMLFLPMFNRQFLPG-PLRYAVGACLGLIVVPQLAPQYAALDIDw--PRLLALL 77
gi 14422433    6 LYQLHSLLAATALGFCRLAPtfyllpFFYLLPFFASGNIPT-VVRHPIIIVVSCALVQHYHYELLNLNEI----DIALFA 80
gi 12082759    6 WSSLFEWLITLAVVSARITP------AFFLLPFLAPAWLSL-TVRTPVIFFIGAALWPYSFGAMASLDGA----RIADIL 74
gi 303895      7 FESIHVFLILLNGVFFRLAP------LFFFLPFLNNGIISP-SIRIPVIFLVASGLITSGKVDIGSSVFE----HVYFLM 75
gi 8996031    13 YSTFQTGLMTLALAWARIAP------VFFFLPFLSSKLLNSgMIKNCVAVFLALGMWPFFSTYELNWEET----SLGEMI 82
gi 3024667     2 AQQVNEWLIALAVAFIRPLS------LSLLLPLLKSGSLGAaLLRNGVLMSLTFPILPIIYQQKIMMHIGk-dYSWLGLV 74
gi 984885     12 SSQGVSLLTLLALCGVRVFV------MFIVLPATAQDSLPG-IARNGVIYVLSSFIAYGQPADALAKIQT---AGLVGVV 81
gi 499216436  12 MHTAIELVVAAGLGAARAIG------IMMILPVFTRSQTDG-LIRGCLAVGFGLPCLAHVSDALQALDPEtrlIEVALLG 84
gi 446925577   1 MNEIMTVIVSSFYCILRPLG------MFIILPIFSTGVLLSnFIRNSIMIAFTLPIIVENYTFSEKLPSGi--FQLTGIA 72
gi 49082920    3 vqdlqqllltyslllPRIIS------CFVVLPVLAKQTLGGgLVRNGVACSLALFAYPIVAGSLPPALGA---LDIALLI 73
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 818893     76 IKEAVLGTLLGLLLYAPFWMFASVGALLDSQRGALS-GGQLNPALGPDATPLGELFQETLIMLVILTGGLSLMTQIIWDS 154
gi 10189622   78 AKEAMVGMFLGWLAALPFWIFEAIGFVIDNQRGASL-GAILNPATGNDSSPMGILFNLGFMVFFLTAGGFGLFATMLYDS 156
gi 14422433   81 AREIIIGLFIACLLASPFWMFLAIGSFIDNQRGATL-SSTLDPATGVDTSELARLFNLFSAAVYLTKGGMNFILETLWQS 159
gi 12082759   75 LREVAIGLLLAILLALPFWVMHGLGALIDYQRGALL-SSAYDPISGVDTSELAKFFNLFFAAVFLQGGGLTLLLEVFLGS 153
gi 303895     76 FKEIIVGLLLSFCLSLPFWIFHAVGSIIDNQRGATL-SSSIDPANGVDTSELAKFFNLFSAVVFLYSGGMVFILESIQLS 154
gi 8996031    83 LYELAIGLVLAFILSLPFLIANIIGELIDNQRGATI-SDTIDPANGVESSEMSVLVSHIVVMIFLTQGGMYQLAQTFAES 161
gi 3024667    75 TGEVIIGFSIGFCAAVPFWAVDMAGFLLDTLRGATM-GTIFNSTIEAETSLFGLLFSQFLCVIFFISGGMEFILNILYES 153
gi 984885     82 FKEAFVGLLIGFAASTVFWIAESVGLLIDDLAGYNN-VQMTNPLSGQQSTPVSTVLLQLAIVSFYALGGMLMLLGALFES 160
gi 499216436  85 LKEVLVGALLGTFLGIPLWGLQAAGEFIDNQRGVTNpSAPTDPATNSQASAMGVFLGITAIAIFVASGGLETLIGALYGS 164
gi 446925577  73 LKEISIGFFIGLSFTILFWAIDAAGQIIDTLRGSTI-SSIFNPSISDSSSITGVILYQFISVIFVIHGGIQSILDKLYLS 151
gi 49082920   74 GKEVLLGLLIGFVATIPFWAMEATGFIIDNQRGAAL-ASTFNPSLGSQTSPTGLLLTQTLITLFFSGGAFLALVGSLFRS 152
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 818893    155 YSVWPPTAWLpGMNAGGLDVFLEQLNQTMQHMLLYAAPFIALLLLIEAAFAIIGLYAQQLNVSILAMPAKSMAGLAFLLI 234
gi 10189622  157 FGLWNIWAWWpSMPAQGAVRMLDQFSGFAARVLLLASPAIVAMFLAELGLALISRFAPQLQVFFLALPVKSALVLFVLVL 236
gi 14422433  160 YNLWLSGN----FNFPKLEPLFSYINNIMTHTIVYASPVIAVMLGGEAVLGLLACYASQLNAFAISLTVKSALAFLILII 235
gi 12082759  154 YQLCDPLE----PSLPSLAKVTTLLQTMATRILILSSPVLVVLLLIEISLGLLSRFAPQMNAFAIALTLKSGVTFFIILI 229
gi 303895    155 YNICPLFS----QCSFRVSNILTFLTLLASQAVILASPVMIVLLLSEVLLGVLSRFAPQMNAFSVSLTIKSLLAIFIIFI 230
gi 8996031   162 YRLLPFAAG---FSHFDSLPLGRWLNQLVVQAIVLAAPILVTLFITEVALGLYSRFCPQLNAFSLSLTIKSAIAFMVFLL 238
gi 3024667   154 YQYLPPGRTL-LFDQQFLKYIQAEWRTLYQLCISFSLPAIICMVLADLALGLLNRSAQQLNVFFFSMPLKSILVLLTLLI 232
gi 984885    161 FRWWPLTQLGpNMGAVAESFVIQQSDSMMAAVVKLSAPVMLVLVLVDLAIGLVARAADKLEPSNLSQPIRGVLALLLLAL 240
gi 499216436 165 YLIWPVYKFYpTLSTQGAMEVLGLLDQIMRTALLVSGPVVFFMTLIDVSFMLLRRFAPQFKLTQLSPAIKNLVFPILMVT 244
gi 446925577 152 YEILPLQADI-AFNRALIDFLFSLWDSFIKLMLSFSVPMIIGIFLCDMGFGFLNKTAPQLNVFTLSLPVKSLIAIFILLL 230
gi 49082920  153 YASWPVSSFFpQLGSQWVAFFYAQFSQMLMLCALFAAPLLIAMFLAEFGLALVSRFAPSLNVFILAMPIKSLVASLLLVL 232
                        250       260
                 ....*....|....*....|....*
gi 818893    235 YLPTLLELGTGQLLKLVDLKSLLTL 259
gi 10189622  237 YMATLFQYAGEILGSVGRIVPFLHS 261
gi 14422433  236 YFAPILAERVMPLSFFPEQLQLYIE 260
gi 12082759  230 YFAPLLPEIFRQYWLLPSQLEIWLS 254
gi 303895    231 CSSTIYFSKVQFFLGEHKFFTNLFV 255
gi 8996031   239 YFQNEVPTILINMISLSPLHDIFGV 263
gi 3024667   233 SFPYALHHYLVESDKFYIYLKDWFP 257
gi 984885    241 LTSVFIAQFGEALGFLHFQQQLHDA 265
gi 499216436 245 YAGYLVEGMKLEITQANGALEWFDR 269
gi 446925577 231 VIH--VFPDFITANIHSDIIDRSLP 253
gi 49082920  233 YLGILMEHAYDALLLAVDPLRLLRP 257
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap