Conserved Protein Domain Family
fliQ

?
TIGR01402: fliQ 
flagellar biosynthetic protein FliQ
This model describes FliQ, a protein involved in biosynthesis of bacterial flagella. A related family of proteins, excluded from this model, participates in bacterial type III protein secretion systems. [Cellular processes, Chemotaxis and motility]
Statistics
?
PSSM-Id: 130469
View PSSM: TIGR01402
Aligned: 12 rows
Threshold Bit Score: 73.0674
Threshold Setting Gi: 416998
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416998     1 MTPESVMMMGTEAMKVALALAAPLLLVALVTGLIISILQAATQINEMTLSFIPKIIAVFIAIIIAGPWMLNLLLDYVRTL 80
gi 544316     1 MSSEFVISMAEKAVYVTLMISGPLLAIALLVGLIVSIFQATTQIQEQTLAFIPKIVAVLLALIFFGPWMLSTILSFTTEL 80
gi 3023764    2 MTQGAVLGLIREGVFQVVLLVAPVLCTALVVGLIVAIFQAVTSIQEQTLTFVPKMLTILGMIALLGGWMLTMLQNYTVRL 81
gi 3023774    1 MTAGHILYLIRISIENIIILSAPMLIIALIVGLLISIFQAITSIQDQTLSFIPKIIVILLVIVIFGPWILNKLMQFTYMI 80
gi 3435110    1 MDFDGSIEHLRLAYWNILLTAGPVLGVALAVGLVIGILQAATSINESTLSFVPKLAIVLLTMALASSFMLTRMTDYFAFV 80
gi 6225368    1 MEQDLIVSLGQRALEMTLLLALPVLLSTFVVGLVVSIFQAATQIQEMTLSYIPKVITAFLVIFLLGGWMMRKLVDFAVEI 80
gi 3023776    1 MTGAEVLDVGRDAIWLTLQLCAPVLIVGLVVGVIIGLFQALTQIQEATLVYAPKIVAIFISLLIFLPLMGSLMSGFMRQI 80
gi 500030994  1 MTADTVQNLVVEALRLALLISAPMLLTALVVGITISLLQAVTQIQEMTLTFIPKILATFLALMLTLPWMIQKLTDYFRHL 80
gi 446109196  1 MTPEIFVELFKESLWLVLIMVCAIIIPSLLVGLVVAIFQAATSINEQTLSFLPRLIITLLALMFFGHWMTQILMDFFYSM 80
gi 499213758  1 MNEADALDIVQYAVWTVLTASAPVVLVAMAVGIGIALIQALTQIQEITLTFVPKIVAIMLVVALTGPFIGGQISAFTNVI 80
gi 490182437  1 MTIEVFLDIMKSGISLLLEIIVPPLVVSLIVGLVISIFQAVTQIHEQTLMFAPRIIVLFLTILFLSGWMAQKILDFFSEM 80
gi 488940215  1 MDESTLVALGVQTFKITLLLSLPMLLAGLIAGLVISIFQATTQINEMTLSFVPKIILVVVILIFLMPWMTTTMIDFTENI 80

                ....*...
gi 416998    81 FTNLPYII 88
gi 544316    81 FSNLNRFA 88
gi 3023764   82 FDIIPQLV 89
gi 3023774   81 FSQLQNV- 87
gi 3435110   81 FETIATIR 88
gi 6225368   81 FANIPVWI 88
gi 3023776   81 AARIA-GM 87
gi 500030994 81 FDTIPTLI 88
gi 446109196 81 IERMPQVL 88
gi 499213758 81 FQRIQNGF 88
gi 490182437 81 LQKYFQMI 88
gi 488940215 81 LNQIPTFI 88
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap