Conserved Protein Domain Family
fliQ_rel_III

?
TIGR01403: fliQ_rel_III 
type III secretion protein, HrpO family
This model represents one of several families of proteins related to bacterial flagellar biosynthesis proteins and involved in bacterial type III protein secretion systems. This family is homologous to, but distinguished from, flagellar biosynthetic protein FliQ. This model may not identify all type III secretion system FliQ homologs. [Protein fate, Protein and peptide secretion and trafficking, Cellular processes, Pathogenesis]
Statistics
?
PSSM-Id: 130470
View PSSM: TIGR01403
Aligned: 8 rows
Threshold Bit Score: 74.2839
Threshold Setting Gi: 17549080
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3024663    5 ELTQFVTQLLWIVLFTSMPVVLVASVVGVIVSLVQALTQIQDQTLQFMIKLLAIAITLMVSYPWLSGILLNYTRQIMLRI 84
gi 1181174    2 DILNLFKQAMLLVVLLSAPPLLVAVIVGVLVSLLQAVMQLQDQTLPFAIKLVAVGIALALSGRWIGVELLELAQQAFTMI 81
gi 10189620   5 DLVSFMTQALYLVLWLSLPPIAVVAIVGTLFSLLQALTQVQEQTLSFAVKLIAVFATLMLAARWISAEIYNFTIAVFDAF 84
gi 447203289  3 DIVYMGNKALYLILIFSLWPVGIATVIGLSIGLLQTVTQLQEQTLPFGIKLIGVSISLLLLSGWYGEVLLSFCHEIMFLI 82
gi 446301570  5 YFVQLCVQTFWIIFILSLPTVIAASVIGIIISLVQAITQLQDQTLPFLLKIIAVFATLALTYHWMGTTIINFSSIIFEMI 84
gi 497917598 11 MLFEYSYEALLLILIISAPPIILASIVGIMVAIFQAATQIQEQTFAFAIKLVVIFGTLMITGGWLCSMILRFAAQIFTNF 90
gi 544849481  5 DILHFTNQTLWLVLVLSLPPVLVAALIGTLVSLVQALTQIQEQTLGFVAKLVAVVVVLFATSGWLGGELYRFAEMTLLKV 84
gi 489356744  5 NITRLTSTALLLCLLVSLPAVGVAAIAGLLISFLQAITSLQDSSISHGLKLIIVSLVIVVAAPWGAAAILQFANSIMQTL 84

                .
gi 3024663   85 G 85
gi 1181174   82 P 82
gi 10189620  85 H 85
gi 447203289 83 K 83
gi 446301570 85 P 85
gi 497917598 91 Y 91
gi 544849481 85 P 85
gi 489356744 85 F 85
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap