Conserved Protein Domain Family
FlhB_rel_III

?
TIGR01404: FlhB_rel_III 
type III secretion protein, YscU/HrpY family
This model represents one of several families of proteins related to bacterial flagellar biosynthesis proteins and involved in bacterial type III protein secretion systems. This family is homologous to, but distinguished from, flagellar biosynthetic protein FlhB (TIGRFAMs model TIGR00328). This model may not identify all type III secretion system FlhB homologs. [Protein fate, Protein and peptide secretion and trafficking, Cellular processes, Pathogenesis]
Statistics
?
PSSM-Id: 130471
View PSSM: TIGR01404
Aligned: 14 rows
Threshold Bit Score: 408.203
Threshold Setting Gi: 547676
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1181176     2 AEKTEKPTAKKLQDARRKGQVPQSQDVPKLLICAGVVETVLALDDVGMQKLQALMMLPLARI-GQPFELALSEVVSSA-I 79
gi 3024668     2 SEKTEQPTEKKLRDGRKEGQVVKSIEITSLFQLIALYLYFHFFTEKMILILIESITFTLQLV-NKPFSYALTQLSHAL-I 79
gi 4324354     3 GEKTEQPTPKKIRDARKKGQVAKSKEVVSTTLIVALSAMLMGLSDYYFEHLSRLMLIPAEQS-YLPFSQALSYVVDNv-L 80
gi 10189624    3 GEKTERPTPKRLRDSREKGEVAHSRDFTQTALICALFGHFLINAPSILASLRALILAPAAFA-DQGFAVALGPVLTEi-L 80
gi 818894      2 SEKTEKATPKQLRDAREKGQVGQSQDLGKLLVLMAVSEITLALADESVNRLEALLSLSFQGI-DRSFAASVELIASEG-F 79
gi 547676      3 DEKTEQPTDKKLEDAHRDGETAKSADLTAAAVLLSGCLLLALTASVFGERWRALLDLALDVDsSRHPLMTLKQTISHFaL 82
gi 730802      2 ANKTEKPTPKKLKDAAKKGQSFKFKDLTTVVIILVGTFTIISFFSLSDVMLLYRYVIINDFE-INEGKY-FFAVVIVF-F 78
gi 8996032     2 AEKTEKPTDKKIRDSAKKGQSFKSKDMVAAVVLVAGAFAISGFSSLYGLGSLLQRILLSPSD-IGVEAL-LDKLYSLF-L 78
gi 447214438   2 SEKTEKPTPKKLRDLKKKGDVTKSEEVMAAVQSLILFSFFSLYGMSFFVDIVGLVNTTIDSL-NRPFLYAIREILGAV-L 79
gi 497916100   2 GEKTEKATPKRLRDARKKGQVAKSQDFPSAITFIVSMFMTFSLSSFFAEHLGGFLVSIFRTA-PQQHDPRLAVYYLKNcL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1181176    80 ILVATFCGLTVAIAALLRIIGGWIQYGPLFAPEALQPDFNRLNPINQFKQMFSVKKLSEMLNSIVKAVAICTIFYLVLTP 159
gi 3024668    80 ESLTSALLFLGAGVIVATVGSVFLQVGVVIASKAIGFKSEHINPVSNFKQIFSLHSVVELCKSSLKVIMLSLIFAFFFYY 159
gi 4324354    81 LEFFYLCFPLLTVAALMAIASHVVQYGFLISGEAIKPDIKKINPIEGAKRIFSIKSLVEFLKSILKVVLLSILIWIIIKG 160
gi 10189624   81 DQAVRVLAPLILIVLGVGMFAEFLQVGVVLAFRKLKPSAEKLNPAGNLKNIFSARNLMEFIKSVCKILFLAVLVTLVIRD 160
gi 818894     80 SVLLSFTLCSVGIAMLMRLISSWMQIGFLFAPKALKIDPNKINPFSHAKQMFSGQNLLNLLLSVLKAIAIGATLYVQVKP 159
gi 547676     83 QLVLMTLPVGFVFALVAWIATWA-QTGVVLSFKPVELKMSAINPASGLKRIFSVRSMIDLVKMIIKGVAVAAAVWKLILI 161
gi 730802     79 KIIGFPLFFC----VLSAVLPTLVQTKFVLATKAIKIDFSVLNPVKGLKKIFSIKTIKEFFKSILLLIILALTTYFFWIN 154
gi 8996032    79 QAVVPVLLAC----FLPGAIISLLQSRFRLATEAVKIDFSHLNPISGFKKIFALRSLKELVKAFLYLLVFATSAAVFFIF 154
gi 447214438  80 NIFLLYILPISLIVFVGTVTTGVSQIGFIFAVEKIKPSAQKISVKNNLKNIFSVKSIFELLKSVFKLVIIVLIFYFMGHS 159
gi 497916100  81 MLILTVSLPLLGAVGFVGLLIGFLVVGPTFSTEVFKPDLKKFNPIENLKQKFKLKTFIELLKSIFKISGAALILYIVLKN 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1181176   160 DLESLSRLAYGDLDSFWPAVETLLIHVSRQTLLTLLVLTLLDFGLQKYFFIKQQRMSHQDIRDEHKQSEGDPHMKGHRHA 239
gi 3024668   160 YASTFRALPYCGLACGVLVVSSLIKWLWVGVMVFYIVVGILDYSFQYYKIRKDLKMSKDDVKQEHKDLEGDPQMKTRRRE 239
gi 4324354   161 NLVTLLQLPTCGIECITPLLGQILRQLMVICTVGFVVISIADYAFEYYQYIKELKMSKDEIKREYKEMEGSPEIKSKRRQ 240
gi 10189624  161 SLQPLMAVPHSGLDGLRTGVGRILQVMVWNIGLAYGAISLADLAWQRYQYRKGLRMSKDEVKQEYKEMEGDPHIKQQRKH 240
gi 818894    160 VLGTLAVLANSDLTTYWHALVELFRHILRVILGLLLAIAMIDFAMQKYFHAKKLRMSHEDIKKEYKQSEGDPHVKGHRRQ 239
gi 547676    162 LMPSIVGAAYQSVMDIAEIGMTLLVRLLAAGGGLFLILGAADFGIQRWLFIRDHRMSKDEVKREHKNSEGDPHIKGERKK 241
gi 730802    155 DRKIIFSQVFSSVDGLYLIWGRLFKDIILFFLAFSILVIILDFVIEFILYMKDMMMDKQEIKREYIEQEGHFETKSRRRE 234
gi 8996032   155 WRQEIFMLYRTTINGMISQWAHLCITFIMVFLAVALLILLIDTLTEFFLFMKDLKMEKQEVKKEYKDNDGDPHIKSARRG 234
gi 447214438 160 YANEFANFTGLNAYQALVVVAFFVFLLWKGVLFGYLLFSVFDFWFQKHEGLKKMKMSKDEVKREAKDTDGNPEIKGERRR 239
gi 497916100 161 RVELVIETAGVPPLVTAQIFKEILYKAVTSIGMFFLVVAVIDLVYQRHSFAKELKMEKFEVKQEFKDTEGNPEIKGRRRQ 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1181176   240 LAHELLNQPATAVkskpVEEADLLLVNPTHYAVALYYRPELTPLPRIICKGEDQQAKELIARAQQANIPVIRFIWLARTL 319
gi 3024668   240 MQSEIQSGSLAQS----VKQSVAVVRNPTHIAVCLGYHPTDMPIPRVLEKGSDAQANYIVNIAERNCIPVVENVELARSL 315
gi 4324354   241 FHQEIQSGNMREN----VKRSSVVVANPTHIAIGILYKRGETPLPLVTFKYTDAQVQTVRKIAEEEGVPILQRIPLARAL 316
gi 10189624  241 LHQELIMHGAAAQ----VRRATVLVTNPTHLAVALYYAAGETPLPRVLAMGQGAVAALMVEAARDAGVPVMQNVALARAL 316
gi 818894    240 LAQEILNQEPSAApk-pLEDADMLLVNPTHYAVALYYRPGETPLPLIHCKGEDEEALALIARAKKAGIPVVQSIWLTRTL 318
gi 547676    242 LARELADEAKPKQs---VAGAQAVVVNPTHYAVAIRYAPEEYGLPRIIAKGVDDEALALREEAAALGIPIVGNPPLARSL 318
gi 730802    235 LHIEILSEQTKSD----IRNSKLVVMNPTHIAIGIYFNPEIAPAPFISLIETNQCALAVRKYANEVGIPTVRDVKLARKL 310
gi 8996032   235 LHQEILSEEVKSN----VRGSTFVMANPTHIAMVIYYNDDIAPLPYLMMKTRGLQAKAVIAYAESQGVPVVRDIPVARQL 310
gi 447214438 240 LHSEIQSGSLANN----IKKSTVIVKNPTHIAICLYYKLGETPLPLVIETGKDAKALQIIKLAELYDIPVIEDIPLARTL 315
gi 497916100 241 IAQEIAYEDTSSQ----IKHASAVVSNPKDIAVAIGYMPEKYKAPWIIAMGVNLRARRIIAEAEKYGVPIMRNVPLAHQL 316
                        330       340
                 ....*....|....*....|....*...
gi 1181176   320 YRS-QEGQLIPRHTLQAVAQVYRVLRQL 346
gi 3024668   316 FFEvERGDKIPETLFEPVAALLRMVMKI 343
gi 4324354   317 YWDaLVDHYIPAEQIEATAEVLRWLERQ 344
gi 10189624  317 HDQaEVDQYIPGELVEPVAAVLRAVRQA 344
gi 818894    319 YRS-KVGKYIPRPTLQAVGHIYKVVRQL 345
gi 547676    319 Y-RvDLYGPVPEPLFETVAEVLAWVGEM 345
gi 730802    311 YKThTKYSFVDFEHLDEVLRLIVWLEQV 338
gi 8996032   311 WRNyRKDSFINDQGLDDVMHIINWLVRV 338
gi 447214438 316 YKNiHKGQYITEDFFEPVAQLIRIAIDL 343
gi 497916100 317 LDEgKELKFIPETTYEAVGEILLYITSL 344
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap