2GWD


Conserved Protein Domain Family
glu_cys_lig_pln

?
TIGR01436: glu_cys_lig_pln 
Click on image for an interactive view with Cn3D
glutamate--cysteine ligase, plant type
This model represents one of two highly dissimilar forms of glutamate--cysteine ligase (gamma-glutamylcysteine synthetase), an enzyme of glutathione biosynthesis. The other type is modeled by TIGR01434. This type is found in plants (with a probable transit peptide), root nodule and other bacteria, but not E. coli and closely related species. [Biosynthesis of cofactors, prosthetic groups, and carriers, Glutathione and analogs]
Statistics
?
PSSM-Id: 130503
View PSSM: TIGR01436
Aligned: 4 rows
Threshold Bit Score: 818.752
Threshold Setting Gi: 6580772
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2GWD_A        15 PLT-REDLIAYLASGCKSKEKWRIGTEHEKFGFEVNTLRPMKYDQ---IAELLNSiAERFEWEKVMEGDKIIGLKQGKQS 90
gi 6580772    13 PIEsRDDLLRIFQAGEKPKAQWRVGTEHEKLVYKKQNHQAPSYEEkggICDLLQG-FTRFGWQPIYENDKIIGLSGDDGA 91
gi 500034499   9 PVTrFDQLVTYLEAGCTPKEQWRIGTEHEKFGFRKRDLTPIPYEGeagIGRLLNSmADRYGWQRVEEDGHVIALIKDGAS 88
gi 12644273   88 PLT-REDLIAYLASGCKTKDKYRIGTEHEKFGFEVNTLRPMKYDQ---IAELLNGiAERFEWEKVMEGDKIIGLKQGKQS 163
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2GWD_A        91 ISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVAEEMGIGFLGMGFQPKWRREDIPTMPKGRYDIMRNYMPKVGSLG 170
gi 6580772    92 ISLEPAGQFELSGAPRSTIHESYDEICRHIQQTQEVGDELGLGFLGLGLWPDKKRSDLPLMPKGRYKIMTEYMPKVGKLG 171
gi 500034499  89 VTLEPGGQLELSGAPLQTIHETQDEINEHLHQLGELCQDMDMAFFGLGVQPKWRFDDIPWMPKGRYRIMRDYLPSRGHLS 168
gi 12644273  164 ISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVAEEMGIGFLGIGFQPKWRREDIPIMPKGRYDIMRNYMPKVGTLG 243
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2GWD_A       171 LDMMLRTCTVQVNLDFSSEADMIRKFRAGLALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRTGMLPFVFDDSF 250
gi 6580772   172 LDMMLRTCTIQSNIDYGSEADMVKKFRVSLALQPLATALFANSPFLEGHPNGFSSYRSHIWTDTDPHRTGILPFVFDDDF 251
gi 500034499 169 LDMMARTCTVQANFDFSSEADMVNKFRLSMALQPLTMALFANSPFLEGKPNGFLSYRGEIWRHTDPDRCGWLPFVFEEGF 248
gi 12644273  244 LDMMLRTCTVQVNLDFSSEADMIRKFRAGLALQPIATALFANSPFTEGKPNGFLSMRSHIWTDTDKDRTGMLPFVFDDSF 323
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2GWD_A       251 GFEQYVDYALDVPMYFAYRNGKYVDCTGMTFRQFLAGKLPCLPGELPTYNDWENHLTTIFPEVRLKRYMEMRGADGGPWR 330
gi 6580772   252 GYERYIDYMLSVPMYFVYRDGRYIDASGQDFRAFLRGELPALPNEKPILSDWVDHLSTAFPEVRLKSYLEMRGADGASAM 331
gi 500034499 249 GFARYAEYALDCPMLFLYEKGVYGSGGGVPFRAFMEGKHPAKPGVYPTLGDWQTHLSTLFPDVRLKHYLELRGADAGNSS 328
gi 12644273  324 GFEQYVDYALDVPMYFAYRKNKYIDCTGMTFRQFLAGKLPCLPGELPSYNDWENHLTTIFPEVRLKRYLEMRGADGGPWR 403
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2GWD_A       331 RLCALPAFWVGLLYDEDVLQSVLDLTADWTPAEREMLRNKVPVTGLKTPFRDG-LLKHVAEDVLKLAKDGLERRGYKEVG 409
gi 6580772   332 MSPALSAFWISILYDSELLDTASDIIKSWSMDDYRNLRNEVPKKGLKTLIGGRqSLLDLGRQLWPLMNDALKRRAILNDK 411
gi 500034499 329 SLCAMPALWKGLLHDETALLAAWDRVKRWSHEERDRIHQETPRLALQTLTPEGiSFRALGLSVLEIARASLHRQGERNAN 408
gi 12644273  404 RLCALPAFWVGLLYDDDSLQAILDLTADWTPAEREMLRNKVPVTGLKTPFRDG-LLKHVAEDVLKLAKDGLERRGYKEAG 482
                        410       420       430       440
                 ....*....|....*....|....*....|....*....|....*.
2GWD_A       410 ------FLNAVTEVVRTGVTPAENLLEMYNGEWGqsVDPVFQELLY 449
gi 6580772   412 gqdesrYLAPIGEILESGQSLSDRLLARYHQTGN--LDFIYQECDW 455
gi 500034499 409 gcdesiFLDPLFITVENNQTPAERLLEAYKGRWRgaVEPLFWEEEF 454
gi 12644273  483 ------FLNAVDEVVRTGVTPAEKLLEMYNGEWGqsVDPVFEELLY 522
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap