Conserved Protein Domain Family
TIGR01440

?
TIGR01440: TIGR01440 
TIGR01440 family protein
Members of this family are uncharacterized proteins of about 180 amino acids from the Bacillus/Clostridium group of Gram-positive bacteria, found in no more than one copy per genome. [Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 130507
View PSSM: TIGR01440
Aligned: 4 rows
Threshold Bit Score: 296.715
Threshold Setting Gi: 15900564
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 446576838   2 KDLTMLLDELKDMSFFNKGDICLIGCSTSEVIGEKIGTVGSMEVAETIFNALDVVSKETGVTFAFQGCEHINRAITIEKS 81
gi 488292957  10 EQLVTITEEVITAGNLKKGDLFVLGCTTSEVVGGVIGKNSSAEVGQWIVSTLIEQLDKKGISLAVQGCEHINRALAMERR 89
gi 499202351   6 QQLETVLGDLQKAKPLSSKHLLVIGVSTSEVAGKQIGTNSSKDVAAALYAALFSYQQKTGVALAFQCCEHLNRALVMERD 85
gi 446929105   8 RETRQVVEDVLEKTNLKQGALFVLGLSSSEVLGGHIGKESSQEIGELIVETILDILGSRGIHLAVQGCEHVNRALVVERQ 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 446576838  82 QYNPLTMEEVSVVPDVHAGGSLATYAFQHMKDPIVVEHITVPCGIDIGQTLIGMHIKHVCVPVRTSVKQVGQAIVTIATS 161
gi 488292957  90 VAEEKGFEIVSVVPQLHAGGSCSVAAFEKFDEPVEVEHIVAQAGIDIGDTSIGMHVKHVQVPLRLSIRTLGAAHVTALYS 169
gi 499202351  86 EAEARGYEEVAVIPVRKAGGAMATYAFTQFRDPVIVEQIRADAGIDIGDTFIGMHLKRVAVPVRSSISAIGDAHVTMAYS 165
gi 446929105  88 VAEQFGLEIVSVHPTLHAGGSGQLAAFKFMQDPVEVEFIKAHAGLDIGDTAIGMHVKHVQVPIRPILREIGHAHVTALAS 167
                        170
                 ....*....|..
gi 446576838 162 RPKKIGGERAKY 173
gi 488292957 170 RPKYIGGPRAHY 181
gi 499202351 166 RPKLIGGVRANY 177
gi 446929105 168 RPKLIGGARAHY 179
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap