Conserved Protein Domain Family
PGP_bact

?
TIGR01449: PGP_bact 
2-phosphoglycolate phosphatase, prokaryotic
PGP is an essential enzyme in the glycolate salvage pathway in higher organisms (photorespiration in plants). Phosphoglycolate results from the oxidase activity of RubisCO in the Calvin cycle when concentrations of carbon dioxide are low relative to oxygen. In Ralstonia (Alcaligenes) eutropha and Rhodobacter sphaeroides, the PGP gene (CbbZ) is located on an operon along with other Calvin cycle enzymes including RubisCO. The only other pertinent experimental evidence concerns the gene from E. coli. The in vitro activity of the Ralstonia and Escherichia enzymes was determined with crude cell extracts of strains containing PGP on expression plasmids and compared to controls. In E. coli, however, there does not appear to be a functional Calvin cycle (RubisCO is absent), although the E. coli PGP gene (gph) is on the same operon (dam) with ribulose-5-phosphate-3-epimerase (rpe), a gene in the pentose-phosphate pathway (along with other, unrelated genes). The E. coli enzyme is not expressed under normal laboratory conditions; the pathway to which it belongs has not been determined. In fact, the possibility exists, although unlikely, that the E. coli enzyme and others within this equivalog have as their physiological substrate another, closely related molecule. The other seed chosen for this model, from Xylella fastidiosa has no experimental evidence, but is a plant pathogen and thus may obtain phosphoglycolate from its host. This model has been restricted to encompass only proteobacteria as no related PGP has been verified outside of this clade. Sequences from Aquifex aeolicus and Treponema pallidum fall between the trusted and noise cutoffs. Just below the noise cutoff is a gene which is part of the operon for the biosynthesis of the blue pigment, indigoidine, from Erwinia (Pectobacterium) chrysanthemi, a plant pathogen. It does not seem likely, considering the proposed biosynthetic mechanism, that the dephosphorylation of phosphoglycolate or a closely related compound is required. Possibly, this gene is fortuitously located in this operon, or has an indirect relationship to the necessity for the biosynthesis of this compound. Sequences from 11 species have been annotated as PGP or putative PGP but fall below the noise cutoff. None of these have experimental validation. This enzyme is a member of the Haloacid Dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolase enzymes (pfam00702). [Energy metabolism, Sugars]
Statistics
?
PSSM-Id: 130516
View PSSM: TIGR01449
Aligned: 4 rows
Threshold Bit Score: 282.865
Threshold Setting Gi: 730313
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 418445     10 VAFDLDGTLVDSAPGLAAAVDMALYALELPVAGEERVITWIGNGADVLMERALTWARQERATQrktmgkppvdddipaee 89
gi 730313     11 VLIDLDGTLVDSAPDIVEAANRMLADFGSPALPFDTVAGFIGRGVPNLVRRVLETAGLTPRVE----------------- 73
gi 3913769     4 VVFDLDGTLVHSAPDIHAAVNKALAEEGGAPFTLAEITGFIGNGVPVLIQRVLAARGEAPDAHr---------------- 67
gi 499197373  15 VLFDLDGTLLDSAPDMLATANAMLAARGRAPITLAQLRPVISIGT--F--RILAVAFPELDAAa---------------- 74
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 418445     90 qVRILRKLFDRYYGEVAEEGTFLFPHVADTLGALQAKGLPLGLVTNKPTPFVAPLLEALDIAKYFSVVIGGDDVQNKKPH 169
gi 730313     74 -AAEAVAMFHRHYAETNGRLGSVFPGVEAGLEALRRQGYRLACVTNKPRALAVPLLALTGLSQYLEVLVAGDSIAQMKPD 152
gi 3913769    68 -QAELQGRFMAHYEADPATLTSVYPGAEAAIRHLRAEGWRIGLCTNKPVGASRQILSLFGLLELFDAIIGGESLPQRKPD 146
gi 499197373  75 -IQGLIPEFLQRYEALIGSVSKPFDGVEMMLDALECAGTVWGIVTNKPEFLARLILPLLGWTSRCAVLIGGDTLAERKPH 153
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 418445    170 PDPLLLVAERMGIAPQQMLFVGDSRNDIQAAKAAGCPSVGLTYGYNYGEAIDLSQPDVIYQSINDLLPAL 239
gi 730313    153 PEPLRHACNLLDVDTAQGVLVGDSAVDVAAARAAGIPVCLVRYGYAGPGGPAALGADALLDSLEALPALL 222
gi 3913769   147 PAPLRATAAALNEEVVL--YVGDSEVDAATAEAAGLRFALFTEGYR-HAPVHELPHHGLFSHHDELQDLL 213
gi 499197373 154 PLPLLTAAERIGVMPTDCVYVGDDVSDIQAARAAGMPSMVALWGYR---SHEDNPMTWQADTLVEQPHLL 220
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap