2P4V


Conserved Protein Domain Family
greB

?
TIGR01461: greB 
Click on image for an interactive view with Cn3D
transcription elongation factor GreB
The GreA and GreB transcription elongation factors enable to continuation of RNA transcription past template-encoded arresting sites. Among the Proteobacteria, distinct clades of GreA and GreB are found. GreB differs functionally in that it releases larger oligonucleotides. This model describes proteobacterial GreB. [Transcription, Transcription factors]
Statistics
?
PSSM-Id: 130528
View PSSM: TIGR01461
Aligned: 4 rows
Threshold Bit Score: 265.201
Threshold Setting Gi: 218767812
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2P4V_A         2 KTPLVTREGYEKLKQELNYLWREERPEVTKKVTWAASLGDRSENADYQYNKKRLREIDRRVRYLTKCMENLKIVDYSPQQ 81
gi 446779481   2 KTPLVTREGYEKLKQELNYLWREERPEVTKKVTWAASLGDRSENADYQYNKKRLREIDRRVRYLTKCLENLKIVDYSPQQ 81
gi 49081530   11 GTPLITPEGAARLRAELHELWHVRRPQVTQAVSEAAALGDRSENAEYIYGKKMLREIDSRVRFLRKRLENLKVVGERPAD 90
gi 488165605   5 TKNYITPAGWQALKDELYQLVNKERPEIVQIVNWAAGNGDRSENGDYLYGKRRMREIDRRIRFLTKRLEAAVVVDPELRE 84
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
2P4V_A        82 E-GKVFFGAWVEIENDDGVTHRFRIVGYDEIFGRKDYISIDSPMARALLKKEVGDLAVVNTPAGEASWYVNAIEYVK 157
gi 446779481  82 E-GKVFFGAWVEIENDDGVTHRFRIVGYDEIFGRKDYISIDSPMARALLKKEVGDLAVVNTPAGEASWYVNAIEYVK 157
gi 49081530   91 P-NRVYFGAWVTLEDEDGEQARYRIVGPDELDLRNNQISIDSPLARALVGKELDAEVLVRTPAGEKLWFVVEIEYPP 166
gi 488165605  85 AtDQVFFGATVGLLRGDGREQTVKIVGIDEIDTAQNKISWISPLARCLIKAREGDEVVLNTPEGREEIEILSVEYIK 161
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap