Conserved Protein Domain Family
cysG_Nterm

?
TIGR01470: cysG_Nterm 
siroheme synthase, N-terminal domain
This model represents a subfamily of CysG N-terminal region-related sequences. All sequences in the seed alignment for this model are N-terminal regions of known or predicted siroheme synthases. The C-terminal region of each is uroporphyrin-III C-methyltransferase (EC 2.1.1.107), which catalyzes the first step committed to the biosynthesis of either siroheme or cobalamin (vitamin B12) rather than protoheme (heme). The region represented by this model completes the process of oxidation and iron insertion to yield siroheme. Siroheme is a cofactor for nitrite and sulfite reductases, so siroheme synthase is CysG of cysteine biosynthesis in some organisms. [Biosynthesis of cofactors, prosthetic groups, and carriers, Heme, porphyrin, and cobalamin]
Statistics
?
PSSM-Id: 130536
View PSSM: TIGR01470
Aligned: 6 rows
Threshold Bit Score: 270.043
Threshold Setting Gi: 9105734
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15159398   20 LPVFWGLEGKRVVLTGGSDGAAWKAELLLACGAQLDLYCEESglsESLATLVAKSPMLTWHDRCWD-ADIFKGAELALAD 98
gi 9105734     7 FPLFANLHDRAVLVVGGGKVAERKTEALLKVGALPIIGAPSL---TASLQHWAETGRITWRQGTFEnSWLQEDIWLVIAA 83
gi 497560194   4 LPIFIDLKSKNVLVIGAGEVGLNKIRILLRAKAKVNVIAKEL---CSEVKLLLRDQKINWLSKNFD-LIYLNKIFLVVSA 79
gi 504415695   4 LPLFHSLQGRLALVVGGGEVALRKARLLADAGARLRVVAPQI---HIELRHLVEQGGGELLERDYQ-DGDQPGCALIIAA 79
gi 1752671     4 FPIFANLAGRPVLVVGGGAVAARKISLLLKAGAEVRVAAKHL---NAELSALAAENKILWLAEEFR-AEHIRTVFLIIAA 79
gi 499213976  11 FPVFVRVEGEAVAIVGGGDEALAKARLIGQSSAVLRIIAENA---EPELLAFIGQSGASHVAAAYD-ASQLEGAVMVFAA 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15159398   99 CEAEEEAGRFYHAARAAGVPVNVIDKPEFCQFQFGSIVNRSPVVVSISTDGAAPILAQAIRRRIETLLPLSLKDWGALAQ 178
gi 9105734    84 TDQPEVNHAAARAAHAQRLFVNVVDDIALSNVQVPAVVERGPLRIAISSGGGAPMVARYLRQQLESLIDDSWGRLTTLFA 163
gi 497560194  80 TNDIKLNQYIFKKCNERCVLVNIVDDKLKCSFIFPSIIDRSPLIVAISSGGTAPVLLRLLREKIEAILPNKLGDVAKIAG 159
gi 504415695  80 TDDEPLNAEVSRAANARGIPVNVVDAPALCSVIFPAIVDRSPLVVAVSSGGDAPVLARLIRAKLETWIPSTYGQLAGLAS 159
gi 1752671    80 SSDQALNRRVFHLAESCQKPVNVVDDRDHCSFIFPSVIDRNPVQIAVSSSGSAPVLARLLRERLEALLPPSLGDMAEISG 159
gi 499213976  87 SGDEALDRRVAADARELGIPVNAVDRPELCDFFTPALVNRAPVAIAIGTEGAGPVLAQMLRGRIDQMLSPSLGSLATLAA 166
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*....
gi 15159398  179 TIRERVNLRLAPGAARRSFWEKFVDRAFTERLDEGSEERLLKDVATRTG 227
gi 9105734   164 QRRDTIRARYPNIEARRRFFETQLTGPLQRLLRKQRHAEAEAVLEAALA 212
gi 497560194 160 KWRLAIKKHFSNFLERRKFWEKLFHSIFVEHILNGNKEQAINVLKKNMN 208
gi 504415695 160 RFRHRVKELLPDLQQRRVFWENLFQGEIAERVLAGRPAEAERLLEEHLA 208
gi 1752671   160 RWRDAVKGKLKSVTERRRFWEKQFNGRFAALVKNRQNTLAERELAGQLE 208
gi 499213976 167 TLRGAAEKLLPKGNARRRFWNSFFEGAPAHAVEAGQLSQAHDAAVDLLL 215
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap