Conserved Protein Domain Family
ubiA_proteo

?
TIGR01474: ubiA_proteo 
4-hydroxybenzoate polyprenyl transferase, proteobacterial
This model represents a family of integral membrane proteins that condenses para-hydroxybenzoate with any of several polyprenyldiphosphates. Heterologous expression studies suggest that for, many but not all members, the activity seen (e.g. octaprenyltransferase in E. coli) reflects available host isoprenyl pools rather than enzyme specificity. A fairly deep split by both clustering (UPGMA) and phylogenetics (NJ tree) separates this group (mostly Proteobacterial and mitochondrial), with several characterized members, from another group (mostly archaeal and Gram-positive bacterial) lacking characterized members. [Biosynthesis of cofactors, prosthetic groups, and carriers, Menaquinone and ubiquinone]
Statistics
?
PSSM-Id: 130539
View PSSM: TIGR01474
Aligned: 11 rows
Threshold Bit Score: 329.664
Threshold Setting Gi: 15604529
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6136094    10 WHAYSRLMRIDRPIGSLLLLWPTYWALWIAAQ---------SIP---------SLHILIVFTAGVFLMRAAGCVINDFAD 71
gi 14250676   71 LQPYLRLMRLDKPIGTWLLYLPCTWSIGLAAEp-------gCFP---------DWYMLSLFGTGAILMRGAGCTINDMWD 134
gi 416820     80 WIPYAELMRLEKPVGTWLLYLPCSWSILMGAMmqg----atLSA---------TAGMLGIFGVGALVMRGAGCTINDFLD 146
gi 259016199  65 WQYYAEISRAGSPTGTYLLYSPCTWSILMAAYayd----ssLVN---------VTKMLALFGVGSFLMRSAGCVINDLWD 131
gi 499195077  54 LDPYWKLARGDRPVGFLLLLWPTWWALWLAAg---------GVP---------PWWTLCVFTTGIWLTRSAGCVINDYTD 115
gi 499271480  27 LWPYAQLARWDRPIGWQLLLLPCLWSAAMAAGaaaslgsfsAGR---------FLFHIFLFTVGAIAMRGAGCTYNDIVD 97
gi 499223710  41 LRPWLKLGRFDRPVGIWLLMLPGWQGIALAAAeq------gRWP---------NPLLLLAVFVGAALMRAAGCAFNDIVD 105
gi 563516532  32 VWPYAQLARWDRPIGWQLLLWPCWWSAALAASa-------yPRPgdpllsllpAPLYLVLFLVGAIAMRGAGCTYNDIVD 104
gi 488178622  15 LDVYLRLMRADKPIGTLLLLWPTYWALWLASD---------GIP---------DLAVLAAFTIGTFLMRSAGCVINDFAD 76
gi 499176487  12 WLTIIYLLRWHKPAGRLILMIPALWAVCLAAQ---------GLP---------PLPLLGTIALGTLATSGLGCVVNDLWD 73
gi 490734036   7 LLIIFKLMRADKPVAYLLVFFPALFGLLLANPs--------NME---------LAYLLPLFIFGSITARSSGCIINDIFD 69
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6136094    72 RHFDGHVERTKHRPLPSGDVTEKEAKILFASLVGLSFLLVLTLNSMTIWLSVAGLALAWIYPFVKRVSHLLQVVLGAAFG 151
gi 14250676  135 QDYDKKVTRTANRPIAAGDISTFQSFVFLGGQLTLALGVLLCLNYYSIALGAGSLLLVITYPLMKRISYWPQLALGLTFN 214
gi 416820    147 RKLDQRVIRSVERPIASGRVSPRRALVFLGAQTLVGMGVLSLLPAQCWWLGLASLPIVFTYPLFKRFTYYPQAALSACFN 226
gi 259016199 132 RELDAKVERSKSRPLASGKLSVRQAISLLSVQLTASLGILLQLNPYTIKLGVASLVPVCIYPAMKRITYYPQVVLGLTFG 211
gi 499195077 116 RWLDPHVERTRIRPLVTGAVSPRNALLMFATLMLIAFGLVLTMNQLTVLLSVVGLFLAMTYPYLKRYTYLPQVYLGLAFG 195
gi 499271480  98 HDIDMEVARTRSRPLPSGRVTRFQAKAFMLLQALVGLVVLLQFNGFTIFLGFLSLALVAIYPFAKRFTDWPQFFLGLAFS 177
gi 499223710 106 RDFDAQVARTAMRPIPAGLISVKQAWLFVVGCCGVSFLILICLGWTAILLGVLSLALVAAYPFMKRITWWPQAWLGLTFN 185
gi 563516532 105 ENIDNQVDRTRSRPLPSGQTTRRRAWLFLVLQALVGLAVLLQFNSFAILLGICSLAIVAIYPFMKRITNWPQLFLGLAFS 184
gi 488178622  77 RDFDGAVERTKNRPFAQGRVKKKEALLLTAFLCLLAALCLIPLNHLTWLMSLPALFLALTYPFTKRFFPIPQLYLGLAFS 156
gi 499176487  74 RDIDPQVERTKQRPLAARALSVQVGIGVALVALLCAAGLAFYLTPLSFWLCVAAVPVIVAYPGAKRVFPVPQLVLSIAWG 153
gi 490734036  70 RKFDKYVERTKKRPLASGAVSVFYAIFILLILSIISLSILLLLNKTAIYTGFFAVIMIILYPLMKRITYFPQIFLGFTFK 149
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6136094   152 WSIPMGFSAVSE----SLPLVCWvLFLVNILWSVIYDTQYAMVDRNDDLKIGVKSTAILFGQYD-KLIIGILQIVMIVLL 226
gi 14250676  215 WGALLGWSAIKGs--cDPSVCLP-LYFSGVMWTLIYDTIYAHQDKRDDVLIGLKSTALRFGENT-KPWLSGFSVAMLGAL 290
gi 416820    227 WGALLGFPAMGv---mSWPTMIP-LYLSSYLWCMTYDTIYAHQDKKFDIKAGIKSTALAWGPRT-KSIMKAMSASQIALL 301
gi 259016199 212 YGAVMGWPALAGeacmNWSVVAP-LYLSTISWIVLYDTIYAHQDKRDDVKANIYSTALRFGDNT-KPVLCGLAALQIATL 289
gi 499195077 196 WGIPMAFAAIQG----KVPTQAWlLYVANILWTTAYDTWCAMVDRDDDIKMGAKSTAILFADLD-LTVQGVLYTLMLFTL 270
gi 499271480 178 WGAIMGWTAEFG----SLSLAAIsLYAAAIAWTIGYDTIYAYQDREDDELIGVRSTARRFGDNP-QPWLIGLYGIAVFLM 252
gi 499223710 186 WGALLGYAAATG----HLSWSAAlLYASGIFWTLGYDTIYAIQDIEDDALAGIKSSTRRLGQHV-QIGVAGFYLVSFILL 260
gi 563516532 185 WGALMGWAVEFG----DLDGPAImLYIGSILWVIGYDTIYAHQDKEDDAIVGVRSTARLFGDNT-KSWLAGLYGGTLICF 259
gi 488178622 157 FGIPMAFAAVAG----NVLPQAWiLFAANVLWTLAYDTVYAMADKEDDLKIGIKTSAVTFGRYD-IAAVMLCHGGFTLLM 231
gi 499176487 154 FAVLISWSAVTG----DLTDATWvLWGATVFWTLGFDTVYAMADREDDRRIGVNSSALFFGQYV-GEAVGIFFALTIGCL 228
gi 490734036 150 LGVLVAYGAVQD----KLDTEAIiMYLACCFWAIGYDTIYGYMDIKDDKKIGVKSLSIYLENKNpKFWLYICYIGFILLF 225
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 6136094   227 VLVGSLAD--LGAVYY-IALSLSALLFIYQQKLMVDRERAPCF--KAFLNNNYVGLILFIGIFLSYL 288
gi 14250676  291 SLVGVNSG--QTAPYY-AALGAVGAHLTHQIYTLDIHRPEDCW--NKFISNRTLGLIVFLGIVLGNL 352
gi 416820    302 AVAGLNSGllWGPGFI-GGLGVFAYRLFSMIKKVDLDNPKNCW--KYFNANINTGLYFTYALAVDYI 365
gi 259016199 290 ATAGIMNG--QGPVFYtLGVAGAAYRLSSMIYKVDLDDPKDCF--RWFKRNSNTGYLVAAAIALDWL 352
gi 499195077 271 CLVGLRAT--LSHTYW-ISLIAAVALIGYQFIIARRREPTACF--RAFMHNNWVGMTIFAGIALATT 332
gi 499271480 253 LFAFLAAG--AGFFAY-VGLLVAAVMLAYQIVVLNIHDPLQCL--ALFKFNGVVGLIIFAGLVLSLL 314
gi 499223710 261 VIAGWMGD--IGPLFL-PLAALFALHLSRQAAAVRIEDGPGAL--KLFKSNALAGLLVFAGLVAGLW 322
gi 563516532 260 AIAFASAQ--APVVAL-AGLIAAGAHMARQIAVLDINDPDQCL--RLFRSNNQVGWLIFLGLIGGAL 321
gi 488178622 232 AVLGAVIG--AAWAYW-TAIPIVLLLQYRQYAAIKSRVRQICF--ETFLANNRIGWVWFTAIFAHTF 293
gi 499176487 229 FYLGMILM--LNPLYW-LSLAIAIVGWVIQYIQLSAPTPEPKLygQIFGQNVIIGFVLLAGMLLGWL 292
gi 490734036 226 ILATKIAN--FN-IDY-LPVLAALILLILQIATLDIKNPVNCI--KRFSANNYVGVLLIMA----FC 282
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap