Conserved Protein Domain Family
STEVOR

?
TIGR01478: STEVOR 
variant surface antigen, stevor family
This model represents the stevor branch of the rifin/stevor family (pfam02009) of predicted variant surface antigens as found in Plasmodium falciparum. This model is based on a set of stevor sequences kindly provided by Matt Berriman from the Sanger Center. This is a global model and assesses a penalty for incomplete sequence. Additional fragmentary sequences may be found with the fragment model and a cutoff of 8 bits.
Statistics
?
PSSM-Id: 130543
View PSSM: TIGR01478
Aligned: 5 rows
Threshold Bit Score: 376.114
Threshold Setting Gi: 4138985
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4138985     1 MLLFLLLFNALLLSQNVNCRNNNYNIRFTQTITQQTSTKSRHLAEIERPKNPHYHNDPELKEIIDKLNEEAIKKYQKTHN 80
gi 3845322     8 MLVMSILLIVLFLSYNVNNHNKKYNVGYIQNNRQMIMMKSRRLAEIQLPKCPHYNNDPELKKIIDKLNEERIKKYIETNN 87
gi 4138983     8 MLLFTFLINTLLLPHYENYLNNDYNVSFIQNNTKRTTIKSRLLAQTQI-HNPHYHNDPELKEIIDKMNEEAIKKYQQTHD 86
gi 4138987     8 MLLLTFLISTLILPHNI----------YNQNNKRGTTKISRLLAQTQN-RNPHYHNDAELKEIIDKLNKEAIQKYQETHD 76
gi 124505195   1 MLLFAFLFNAFLLSQRVKCINKIGNISLIKNNTQSISTKSRYLAEIERPNNPHYYNDPELKEIIDKLNKEAIKKYQKNHD 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4138985    81 PYEQLQDLVEKKATKTRGGYGAEPMSTIEKELLKKYEEMFGDESHIMLKSGMYTNE-------GNKSCECSYKK----KS 149
gi 3845322    88 SFEELHGLLVKERTKSLYENGMKKSSNMEKELLKKYDDSIRDEHNVISKSGIYTSDyr---klYDKSCDYQNQKilrdEL 164
gi 4138983    87 PYEQLKEVVEKNGTKYSGGNDAEPISTLEKELLETYEEIFGNESD-MLKSGMSPNvd-----eKSSTFECTDINg---VK 157
gi 4138987    77 PYEQLQELVEQNRTINTDKHGTEPMSTIEKELLETHQEMFGEENHIILKSGMYKNDddr--tdKSSTCESTDTNn---TE 151
gi 124505195  81 PYEQLKEVVEKNQTKVTGGNDAEPMSTLEKDLLEIYEKLFGDKSHIMIKSNIYINQddksndkNDKSCECANYKky-nQL 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4138985   150 SSSNKVHENYLNNLKEGCIAGVGTCAFSSALLGKFGIAAGATAAYQAAIGSLPVLAPYITSNTI-GVNFFFLSSLETAIK 228
gi 3845322   165 ASCCKVHDNYLDNLKKGCFGGVGICTLCSLLVSNIGIGYAVTAAKEVITGLYSLDIANKFTKALaGIYFFFSSSIENAGV 244
gi 4138983   158 LAKTKGRDKYLKHLKGRCTRGIYFCSLGSVILTYIGTTAAKGAAI-STAGAGS---K-NCIYAIsIFHMLNHKS-MSSAL 231
gi 4138987   152 LAKTKGKDKYLKHLKKRCTRGICSCSVLSAFLTMLGLAFAKKAAL-VPFASYGK--TSTCSSVLtLTNMINFVTLESILK 228
gi 124505195 160 LSSYSVDDAYLHNLKSGCVACVGTSALSSIITGLYGISAASTAAIEAIKTTSSATIITKLTKSLfGINFFSQTSIESAYI 239
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 4138985   229 TGAptLSHlmgsfNTFESAVTAGTSTFFPYGMAIVVLIALTIIVIILYVWLRKKRKKLMESRMK 292
gi 3845322   245 SGVt-IFY-----WDSMRMASIASSTINPYGIAALVLIVLVVVLIVLYIWLYRRRKKSWKHECK 302
gi 4138983   232 TALg-TVGca--aDYASGATSASA-IFLPCGIAALVLLILTVLLIILYIWLYRRRKRSWKHECK 291
gi 4138987   229 ATTg-CAVga--sDVALPAATSANAIFGPCGIAALVLLILAVVLVILYIWLYKRRKNSWKHECK 289
gi 124505195 240 TAG--ITS-----VEGELYAGLVTSTFLPYGIVAIVLILVIVALIMLYIWFYRRRKSSWKYAYK 296
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap