Conserved Protein Domain Family
ccpA

?
TIGR01481: ccpA 
catabolite control protein A
Catabolite control protein A is a LacI family global transcriptional regulator found in Gram-positive bacteria. CcpA is involved in repressing carbohydrate utilization genes [ex: alpha-amylase (amyE), acetyl-coenzyme A synthase (acsA)] and in activating genes involved in transporting excess carbon from the cell [ex: acetate kinase (ackA), alpha-acetolactate synthase (alsS)]. Additionally, disruption of CcpA in Bacillus megaterium, Staphylococcus xylosus, Lactobacillus casei and Lactocacillus pentosus also decreases growth rate, which suggests CcpA is involved in the regulation of other metabolic pathways. [Regulatory functions, DNA interactions]
Statistics
?
PSSM-Id: 130546
View PSSM: TIGR01481
Aligned: 5 rows
Threshold Bit Score: 560.565
Threshold Setting Gi: 15903855
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3941404     7 TITIYDVAHEAGVSMATVSRVVNGNPNVKPATRKKVLDVIRRLGYRPNAVARGLASKRTTTVGVVIPDISNAFYAELTRG 86
gi 16411028    2 NVTIYDVAREANVSMATVSRVVNGNPNVKPVTRKKVLDVINQLGYRPNAVARGLASKRTTTVGVIIPDISNVFYAELARG 81
gi 14331034    5 TVTIYDVAAEAAVSMATVSRVVNGNPNVKPATAKKVLAVIERLDYRPNAVARGLASKRSTTVGVIIPDVTNIYFAALRPG 84
gi 446141211   2 TVTIYDVAREARVSMATVSRVVNGNQNVKAETKNKVNEVIKRLNYRPNAVARGLASKKTTTVGVIIPDISNIYYSQLARG 81
gi 487767841  16 TVTIYDVAREAGVSMATVSRVVNGNKNVKENTRKKVLEVIDRLDYRPNAVARGLASKKTTTVGVVIPNITNGYFSSLAKG 95
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3941404    87 IEDIATMYHYNIILSNSDLQKDRELQLIETLLEKQVDGLLFLGGEITEAHREIFSATPVPVVLAASRDEKKELPYVTIDR 166
gi 16411028   82 IEDIATMYKYNIILSNSDENEDKELQVLNTLLGKQVDGIIYMGERISEQLQEEFDRSPAPVVLAGAVDMENKFASVNIDY 161
gi 14331034   85 IDDIAMMYKYNIILTNSDDAGEQEVNVLNTLMGKQVDGVIFMGNYIDDKLRAEFKRAKAPVVLAGTVDPNNESPSVNIDY 164
gi 446141211  82 LEDIATMYKYHSIISNSDNDPEKEKEIFNNLLSKQVDGIIFLGGTITEEMKELINQSSVPVVVSGTNGKDAHIASVNIDF 161
gi 487767841  96 IDDIAEMYKYNIVLANSDEDNEKEVSVVNTLFSKQVDGIIYMGYHLTDKIRSEFSRSRTPIVLAGTVDVEHQLPSVNIDY 175
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3941404   167 IQASKEATLILGHEGHKHVGFIGGPLTDSVNGYPRYLGYKEALKEMDIAFEEDLIRLGDYRYRSGYKAMRELLESRPeiT 246
gi 16411028  162 KQATKEAVKRFVDNGHKQIAFVSGSLNEPVNREMKLAGYKEALEEAGISYQEDYIIEAKYNYNAGVKVWAELSALSKkpN 241
gi 14331034  165 AAAVEEVVTNLIARGHKKIALALGSLSQSINARIPTDGLQTGLNQGKIPFDDALVYEAGYSYDAGRKLQPVIADSGP--T 242
gi 446141211 162 TEAAKEITGELIEKGAKSFALVGGEHSKKAQ-EDVLEGLTEVLNKNGLQLGDTLNCSGAESYKEGVKAFAKMKGNLP--D 238
gi 487767841 176 KQATIDAVS-YLAKENERIAFVSGPLVDDINGKVRLVGYKETLKKAGITYSEGLVFESKYSYDDGYALAERLISSNA--T 252
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3941404   247 AVFAASDEMAVGALHAALDMGRDVPNDLSVIGFENIPLASQVRPLLSTVGVPMYDIGAVAMRLLTKYMNEEQVETGQVYL 326
gi 16411028  242 AVVVADDELAIGILNAALDAGIKVPEDLEVMTSNNTKLTLMSRPQLSTIVQPLYDIGAVAMRLLTKLMTSEEVDEKTVIL 321
gi 14331034  243 AVFVGDDEMAAGLINASMESGINVPDDLEVVTSNDTIITQITRPAITSITQPLYDIGAVAMRMLTKLMNDKELDEKTVTL 322
gi 446141211 239 AILCISDEEAIGIMHSAMDAGIKVPEELQIISFNNTRLVEMVRPQLSSVIQPLYDIGAVGMRLLTKYMNDEKIEEPNVVL 318
gi 487767841 253 AAVVTGDELAAGVLNGLADKGVSVPEDFEIITSDDSQISRFTRPNLTTIAQPLYDLGAISMRMLTKIMHKEELEEREVLL 332
                        330
                 ....*....|.
gi 3941404   327 PYHIQLRESTR 337
gi 16411028  322 PHSEKLRGTTK 332
gi 14331034  323 PYGIVRRGSTK 333
gi 446141211 319 PHRIEYRGTTK 329
gi 487767841 333 PHGLTERSSTR 343
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap