1XVI,1WZC,3ZTW


Conserved Protein Domain Family
HAD-SF-IIB-MPGP

?
TIGR01486: HAD-SF-IIB-MPGP 
Click on image for an interactive view with Cn3D
mannosyl-3-phosphoglycerate phosphatase family
This small group of proteins is a member of the IIB subfamily (TIGR01484) of the Haloacid Dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases. Several members of this family from thermophiles (and from Dehalococcoides ethenogenes) are now known to act as mannosyl-3-phosphoglycerate (MPG) phosphatase. In these cases, the enzyme acts after MPG synthase to make the compatible solute mannosylglycerate. We propose that other mesophilic members of this family do not act as mannosyl-3-phosphoglycerate phosphatase. A member of this family is found in Escherichia coli, which appears to lack MPG synthase. Mannosylglycerate is imported in E. coli by phosphoenolpyruvate-dependent transporter (), but it appears the phosphorylation is not on the glycerate moiety, that the phosphorylated import is degraded by an alpha-mannosidase from an adjacent gene, and that E. coli would have no pathway to obtain MPG.
Statistics
?
PSSM-Id: 130550
View PSSM: TIGR01486
Aligned: 12 rows
Threshold Bit Score: 269.657
Threshold Setting Gi: 150421599
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1XVI_A        11 LVFSDLDGTLLDSHSyDWQPAAPWLTRLREANVPVILCSSKTSAEMLYlqktLGLQg--LPLIAENGAVIQLAEQW---- 84
gi 28950685    2 IVFTDLDGTLLDERG-ELGPAREALERLRALGVPVVPVTAKTRKEVEA----LGLE---PPFIVENGGGLYLPRDW---- 69
gi 28380064    4 LIFLDIDKTLIPGYE--PDPAKPIIEELKDMGFEIIFNSSKTRAEQEYyrkeLEVE---TPFISENGSAIFIPKGY---- 74
gi 150421599   9 VIFTDLDNTLVGPGG-EAGEAGEVYLEALDLGYRVVPVTSKSIYEIVElwdsIGVPpgeRIALAESGGAIYGPRGS---- 83
gi 33237706   11 WIVTDIDGTLMD-HQyDFSPALSTIKWLQELGIPIIPCTSKTAAEVRAlrleLGIT---DPFIVENGGAIYGDELS---- 82
gi 33634093    8 WVVSDVDGTLMD-HSyDLTPAKETIKLLQELSIPVILCTSKTAAEVKVirkeLNLT---DPYIVENGAAIHGETLK---- 79
gi 33639565   10 WVVTDLDGTLMD-HHyDWAPAAAVLRSLQRAGVPVIPCTSKTAEEVERfraaAQLR---DPYIVENGGAIHGETAT---- 81
gi 3287952     9 LVFSDLDGTLLDSHSyDWQPAAPWLTRLREANVPVILCSSKTSAEMLYlqktLGLQg--LPLIAENGAVIQLAEQW---- 82
gi 49611702    9 IIFSDLDGSLLDHETyRWDAAQRWLTRLANEAIPLIITTSKTAAEVEPlqqaLGLDd--YPYIAENGAIAVLPPTW---- 82
gi 32365727   10 VIFTDLDGTLLDLHTyDPGPAREAVARLQERGIPIVFCSSKTRAEQLSyrrqLGIR---DPFIVENGATIFIPRGY---- 82
1WZC_A         4 LIFLDIDKTLIP--GyEPDPAKPIIEELKDMGFEIIFNSSKTRAEQEYyrkeLEVE---TPFISENGSAIFIPKGY---- 74
3ZTW_A         2 IVFTDLDGTLLDERG-ELGPAREALERLRALGVPVVPVTAKTRKEVEa----LGLE---PPFIVENGGGLYLPRDWpvra 73
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1XVI_A        85 -Qe-----IDG-------F---PRIISGISHGEISLVLNTLREKEHFKFTTFDDVDDATIAEWTGLSRSQAALTQLHEAS 148
gi 28950685   70 -Pvr--agRPK-------Gg-yRVVSLAWPYRKVRARLREAEALAGRPILGYGDLTAEAVARLTGLSREAARRAKAREYD 138
gi 28380064   75 -FpfdvkgKEV-------Gn-yIVIELGIRVEKIREELKKLENIYGLKY--YGNSTKEEIEKFTGMPPELVPLAMEREYS 143
gi 150421599  84 -LarptgfNSE-------Vg-lEYTALGKPLASIDALLDSLAETCGAVR--LSKADATEAQLITGLPRERAALAARREYL 152
gi 33237706   83 -Sn-----EE------------WELVLGKSYKYLRSKLELISLELGYKLIPLNDLSYQEINELTGLEGRGIELALDRKWS 144
gi 33634093   80 -R------VN------------GEIILGEKYEILENILISISNEINYNLQPLNNISDQEATELTGLKGHSLDLMRDRHWS 140
gi 33639565   82 -G------EP------------WQEALGPGWTVLKPRLQELSEQLSEPLRALDELTDAEGERLLGLSGELLQQAQRRRCS 142
gi 3287952    83 -Qe-----IDG-------F---PRIISGISHGEISLVLNTLREKEHFKFTTFDDVDDATIAEWTGLSRSQAALTQLHEAS 146
gi 49611702   83 -Rt-----HPE-------Y---PRKRMGSGYSIIRTQLEQLHASG-FRFKGFGDMSCAEIAEVTGLSEQDARRAQQREAS 145
gi 32365727   83 -FtvpreaRPT-------ShglEVIELGRPAAEIRRALREIRKETGLSFRGYHEMTVEEVAELTGLPPEAARRAMTREYS 154
1WZC_A        75 -Fp-----FDVkgkevgnY---IVIELGIRVEKIREELKKLENIYGLKY--YGNSTKEEIEKFTGMPPELVPLAMEREYS 143
3ZTW_A        74 gRp-----KGG-------Y---RVVSLAWPYRKVRARLREAEALAGRPILGYGDLTAEAVARLTGLSREAARRAKAREYD 138
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1XVI_A       149 VTLIWrdSDERMAQFTARLNELGLQFMQGARFWHVLdASAGKDQAANWIIATYQQLsGKRPTTLGLGDGPNDAPLLEVMD 228
gi 28950685  139 ETLVL--CPEEVEAVLEALEAVGLEWTHGGRFYHAA-KGADKGRAVARLRALWPDP-EEARFAVGLGDSLNDLPLFRAVD 214
gi 28380064  144 ETIFE----WSRDGWEEVLVEGGFKVTMGSRFYTVH-GNSDKGKAAKILLDFYKR--LGQIESYAVGDSYNDFPMFEVVD 216
gi 150421599 153 EVIWSrsQECLDTILSTALRYRELTYVHRAPRTVQIaAHRGKGMAIDAALQEPLLR-PCAKVVVTAGDSSHDIPIIERGM 231
gi 33237706  145 VPFLNp-KDSDRERITEIASSLCTSIYKGNRMSHLLgEGSHKGKAVIELKKFLNQP---NIKVVALGDSQNDLPLLEVAD 220
gi 33634093  141 MPFLNp-PENKEEEINICCKRFGVEIFRGNRMSHMLsINSNKGKAINALKNYSNNP---NIKIIGLGDSPNDLPLLLNSD 216
gi 33639565  143 VPFVPp-SVAIQPRLDALSAAQGLAVVRGNRMCHLLgAEVSKGNALAALKQRLHEP---DVKVLALGDSPNDLPLLEVAD 218
gi 3287952   147 VTLIWrdSDERMAQFTARLNELGLQFMQGARFWHVLdASAGKDQAANWIIATYQQLsGKRPTTLGLGDGPNDAPLLEVMD 226
gi 49611702  146 EPLLWldDASRLPHFRQLLADVGLALTQGGRFYHVMgTQTSKGFTGNWIKTQYIEKyGTDVKTLGLGDGPNDLSLLCTVD 225
gi 32365727  155 ETIIVdfGPADWQRFNAALVAHGLVCFAGGRFHTVVgLGTDKGQAVHRLAELYRQQ-HGAILTVGLGDSPNDVPMLRAVD 233
1WZC_A       144 ETIF----EWSRDGWEEVLVEGGFKVTMGSRFYTVHg-NSDKGKAAKILLDFYK-R-LGQIESYAVGDSYNDFPMFEVVD 216
3ZTW_A       139 ETLVL--CPEEVEAVLEALEAVGLEWTHGGRFYHAa-KGADKGRAVARLRALWPDP-EEARFAVGLGDSLNDLPLFRAVD 214
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|...
1XVI_A       229 YAVIVKGLNregvhlHDe-DpaRVWRTQREGPEGWREGLDHFF 270
gi 28950685  215 LAVYVGRGD------PP--E--GVLATPAPGPEGFRYAVERYL 247
gi 28380064  217 KAFIVG----------------SLKHKKAQNVSSIIDVLEVIK 243
gi 150421599 232 LAFRVDYNRdwsrlvKP-----IYMVIPYEAPKAWTMLIETVK 269
gi 33237706  221 IAIVIPSRNgpnkflKKgiDkgEFLLAPAPHSEGWALAIRDLL 263
gi 33634093  217 YKIVIPGPGgpnlklIEklNeySFTLATDPNGYGWKSEINKLI 259
gi 33639565  219 LAVVVPGAEgphprlRLgvEsgRFELARAPHAEGWAEAVERLL 261
gi 3287952   227 YAVIVKGLNregvhlHDe-DpaRVWRTQREGPEGWREGLDHFF 268
gi 49611702  226 CAVLIKGKGnqivslPEs-YagEQYCTQASGPQGWSEGLDHFI 267
gi 32365727  234 RPFLVQRPDgtwesvDV--P--GLVPIPAPGPEGWCMAVEQLL 272
1WZC_A       217 KVFIVg----------------SLKHKKAQNVSSIIDVLEVIK 243
3ZTW_A       215 LAVYVGRGD----------PpeGVLATPAPGPEGFRYAVERYL 247
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap