Conserved Protein Domain Family
kdpB

?
TIGR01497: kdpB 
K+-transporting ATPase, B subunit
This model describes the P-type ATPase subunit of the complex responsible for translocating potassium ions across biological membranes in microbes. In E. coli and other species, this complex consists of the proteins KdpA, KdpB, KdpC and KdpF. KdpB is the ATPase subunit, while KdpA is the potassium-ion translocating subunit. The function of KdpC is unclear, although cit has been suggested to couple the ATPase subunit to the ion-translocating subunit, while KdpF serves to stabilize the complex. The potassium P-type ATPases have been characterized as Type IA based on a phylogenetic analysis which places this clade closest to the heavy-metal translocating ATPases (Type IB). Others place this clade closer to the Na+/K+ antiporter type (Type IIC) based on physical characteristics. This model is very clear-cut, with a strong break between trusted hits and noise. All members of the seed alignment, from Clostridium, Anabaena and E. coli are in the characterized table. One sequence above trusted, OMNI|NTL01TA01282, is apparently mis-annotated in the primary literature, but properly annotated by TIGR. [Transport and binding proteins, Cations and iron carrying compounds]
Statistics
?
PSSM-Id: 130561
View PSSM: TIGR01497
Aligned: 3 rows
Threshold Bit Score: 1144.62
Threshold Setting Gi: 2772548
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18266748   2 KSKKSKFITKDILKEAIIESFKKLNPKYMMKNPVMFVVEVGFFVTILLTIFPSIFGDKG-HNLRVYNLIVTIILFITVLF 80
gi 12229588  23 ARKKAKIKTKGIYLRAIGDAFVKLNPKSAIRNPVMFLVWVGTIITLSVTIEPNLFGTTQqKNPQLFNGILTGILFFTVWF 102
gi 2772548    2 SRKQLALFEPTLVVQALKEAVKKLNPQAQWRNPVMFIVWIGSLLTTCISIAMASGAMPG-N--ALFSAAISGWLWITVLF 78
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18266748  81 ANFAESVAEGRGKAQADALKKTRKDTIAKLIGKD---GSIKTINANELKKGDVVLVENGDVIPNDGEVVDGVASVDESAI 157
gi 12229588 103 ANFAEAVAEGRGKAQADTLRSTKSETLAKLLSPD---GKITDVPSTSLKQGDTVYVVAGDVIPADGEVIMGVASVDESAI 179
gi 2772548   79 ANFAEALAEGRSKAQANSLKGVKKTAFARKLRDAkygAAADKVPADQLRKGDIVLVEAGDIIPCDGEVIEGGASVDESAI 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18266748 158 TGESAPVMKEPGGDFAS-VTGGTKVVSDWLKVEITATPGESFLDKMINLVEGASRQKTPNEIALNTILVSLTLIFLIVLV 236
gi 12229588 180 TGESAPVLKESGSDIASsVTGGTRIISDELIVRVTADPGKGFIDRMIALVEGAERTKTPNEVALTVLLAVLSLVFLFVVA 259
gi 2772548  159 TGESAPVIRESGGDFAS-VTGGTRILSDWLVIECSVNPGETFLDRMIAMVEGAQRRKTPNEIALTILLIALTIVFLLATA 237
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18266748 237 ALYPMATYTGVKIPMSTLIALLVCLIPTTIGGLLSAIGIAGMDRVTRFNVIAMSGKAVEACGDVDTMILDKTGTITYGNR 316
gi 12229588 260 TLPVFAYYADTPINVPILVALLVALIPTTIGGLLSAIGIAGMDRVAQFNVIATSGRAVEACGDVNTLVLDKTGTITLGNR 339
gi 2772548  238 TLWPFSAWGGNAVSVTVLVALLVCLIPTTIGGLLSAIGVAGMSRMLGANVIATSGRAVEAAGDVDVLLLDKTGTITLGNR 317
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18266748 317 LAADFITVGGADKQKLIDYSVMCSLKDDTPEGKSIVELGKQ-LGITIDTKKYEsIEFEEFTAQTRMSGIKLENGTAVKKG 395
gi 12229588 340 LAEEFIPINGHSIEQVASVAWVASVFDDTPEGKSIVRLAEK-LGIRYDLDPNQ-AQGVEFSAKTRMSGTNLPGGREARKG 417
gi 2772548  318 QASEFIPAQGVDEKTLADAAQLASLADETPEGRSIVILAKQrFNLRERDVQSLhATFVPFTAQSRMSGINIDN-RMIRKG 396
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18266748 396 AYDAIKKRVQELKGVIPKDLDEAVNKVAKLGGTPLVVCVDNKIYGVIYLKDTVKPGLVERFERLREIGIKTIMCTGDNPL 475
gi 12229588 418 AVGAIKGFVRSRNGRITPELDVAYEQVSQQGGTPLAVCLDNEIYGVIYLKDIVKSGIRERFDQLRRMGVRTIMLTGDNRI 497
gi 2772548  397 SVDAIRRHVEANGGHFPTDVDQKVDQVARQGATPLVVVEGSRVLGVIALKDIVKGGIKERFAQLRKMGIKTVMITGDNRL 476
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18266748 476 TAATIAKEAGVDGFIAECKPEDKIEAIKKEQDEGKLVAMTGDGTNDAPALAQADVGLAMNSGTTAAKEAANMVDLDSDPT 555
gi 12229588 498 TASVIAQEAGVDDFIAEATPEDKISVIQREQAQGKLVAMTGDGTNDAPALAQANVGVAMNTGTQAAKEAANMVDLDSDPT 577
gi 2772548  477 TAAAIAAEAGVDDFLAEATPEAKLALIRQYQAEGRLVAMTGDGTNDAPALAQADVAVAMNSGTQAAKEAGNMVDLDSNPT 556
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18266748 556 KVLEVVEIGKQLLITRGALTTFSIANDVAKYFAIIPAIFTIAIpkMQLMNIMHLSTPYSAILSALIFNAIIIPALIPIAM 635
gi 12229588 578 KLIDIVSIGKQLLITRGALTTFSLANDIAKYFAIIPVIFASAN--LQSLNVMNLTSTNSAVLSALIYNALIIPALIPLAL 655
gi 2772548  557 KLIEVVHIGKQMLMTRGSLTTFSIANDVAKYFAIIPAAFAATYpqLNALNIMCLHSPDSAILSAVIFNALIIVFLIPLAL 636
                       650       660       670       680
                ....*....|....*....|....*....|....*....|.
gi 18266748 636 KGVKYRPMKSEALLLRNMIVFGFGGIIVPFVGIKIIDMIIT 676
gi 12229588 656 KGVQFRPLTANQLLQRNILIYGLGGVIAPFIAIKLIDVLIT 696
gi 2772548  637 KGVSYKPLTASAMLRRNLWIYGLGGLLVPFIGIKVIDLLLT 677
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap