1CCW


Conserved Protein Domain Family
MthylAspMut_E

?
TIGR01503: MthylAspMut_E 
Click on image for an interactive view with Cn3D
methylaspartate mutase, E subunit
This model represents the E (epsilon) subunit of methylaspartate mutase (glutamate mutase), a cobalamin-dependent enzyme that catalyzes the first step in a pathway of glutamate fermentation. [Energy metabolism, Amino acids and amines, Energy metabolism, Fermentation]
Statistics
?
PSSM-Id: 130567
View PSSM: TIGR01503
Aligned: 5 rows
Threshold Bit Score: 812.136
Threshold Setting Gi: 15791097
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1CCW_B         3 LKNKKWTDEEFHKQREEVLQQWPTGKEVD-LQEAVDYLKKIPAEKNFAEKLVLAKKKGITMAQPRAGVALLDEHIELLRY 81
gi 19713097    3 ITFKKIDKEDFLEIRKNFLENYKNLDDFD-LNTAIRFHKSLPDHKNFQKKIEQSVQDNKIMTQAHSKETLLEDLIKNLNT 81
gi 2507035     3 LKNKKWTDEEFHKQREEVLQQWPTGKEVD-LQEAVDYLKKIPAEKNFAEKLVLAKKKGITMAQPRAGVALLDEHIELLRY 81
gi 446345465   3 LRNKKLTHDEFMTERQQVLKTWETGKDVEnFEDGVKYQQTIPEHKRFSLALLKADKEGKTLSQPRAGVALMDEHIELLKT 82
gi 499206162   2 IEDKRLTDTELEAITDRITGDWVSRAAVD-FADAVAFHESLPPHKRFAAVLENAE---AVLCQPRAGVPRLDEHVELLQH 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1CCW_B        82 LQDEGGADFLPSTIDAYTRQNRYDECENGIKESEKAGRSLLNGFPGVNFGVKGCRKVLEAVNLPLQARHGTPDSRLLAEI 161
gi 19713097   82 FYRVGQADFLSIIIDSHTRENHYDNAKVILEDSIKSNKSLLNGFPLINYGTKLARKIINDVEVPLQIKHGSPDARLLVEV 161
gi 2507035    82 LQDEGGADFLPSTIDAYTRQNRYDECENGIKESEKAGRSLLNGFPGVNYGVKGCRKVLEAVNLPLQARHGTPDSRLLAEI 161
gi 446345465  83 LQEE--CDLLPSTIDAYTRLNRYEEAAVGIKKSIEAGTSKLNGLPVVNHGVAACRRLTETLQKPLQIRHGTPDARLLAEI 160
gi 499206162  78 LDEEGGADLLPTTIDSYTRDNAYEKAAEGLARSRETDSSELNGFPAVNHGVEGCREVVRRVDAPVQVRHGTPDARLLAAV 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1CCW_B       162 IHAGGWTSNEGGGISYNVPYAKNVTIEKSLLDWQYCDRLVGFYEEQGVHINREPFGPLTGTLVPPSMSNAVGITEALLAA 241
gi 19713097  162 ALLSGFSAFDGGGISHNIPFSKSISLKDSLENWKYVDRLVGIYEENGIKINREIFSPLTATLVPPAISNSIQILETLLAV 241
gi 2507035   162 IHAGGWTSNEGGGISYNVPYAKNVTIEKSLLDWQYCDRLVGFYEEQGVHINREPFGPLTGTLVPPSMSNAVGITEALLAA 241
gi 446345465 161 SMASGFTSYEGGGISYNIPYAKRVTLEKSIRDWQYCDRLMGMYEEHGIRINREPFGPLTGTLIPPFISHSIAIIEGLLAL 240
gi 499206162 158 TLAGGFQSFEGGPITYNLPYTSAYDLETTIEYWQYVDRLCGAYTERGVTINREPFGPLTGTLVPPSIAIAIVTIEGLLAA 237
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1CCW_B       242 EQGVKNITVGYGECGNMIQDIAALRCLEEQTNEYLKAYGYNDVFVTTVFHQWMGGFPQDESKAFGVIVTATTIAALAGAT 321
gi 19713097  242 EQGVKNISIGVAQYGNITQDIASLLALKEHIQFYLDTFSFKDINISTVFNQWIGGFPEEELKAYSLISYSTTIALFSKTN 321
gi 2507035   242 EQGVKNITVGYGECGNMIQDIAALRCLEEQTNEYLKAYGYNDVFVTTVFHQWMGGFPQDESKAFGVIVTATTIAALAGAT 321
gi 446345465 241 EQGVKSITVGYGQVGSLTQDVAAIQSLRELAHEYFQSYGYTDYELSTVFHQWMGGFPEDESKAFAIISWGAAVAGMSGAT 320
gi 499206162 238 TQGVRSVTLGYGQVGNLVQDVAAVRAMAAIGAEYLPDS----VTVTTVLHQWMGGFPRDEARAHGVIGLAGATAALVEPT 313
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1CCW_B       322 KVIVKTPHEAIGIPTKEANAAGIKATKMALNMLEGQRMPMSKELETEMAVIKAETKCILDKMFELGKGDLAIGTVKAFET 401
gi 19713097  322 RIFVKNIDEYAKNSLGNTMINSLLLTKTILDIGNNQKINNYEEIIFEKEQIKKETAQIIAKIFSRCDGDLRKAIIEAFEY 401
gi 2507035   322 KVIVKTPHEAIGIPTKEANAAGIKATKMALNMLEGQRMPMSKELETEMAVIKAETKCILDKMFELGKGDLAIGTVKAFET 401
gi 446345465 321 KVITKSPHEAWGIPTAAANIQGLKASRQMLNMVNEQKFPPCPAVELEIELIKSEVRAVLNKVFELGNGDIARGTVLAFEA 400
gi 499206162 314 KVITKSPQEAVGVPTAESNAAGLRTTDQVLRMLDEQSITLD-GVDREQALIERSVRSLLDAVYEAGDGDIARGTVRAFDA 392
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1CCW_B       402 GVMDIPFGPSKYNAGKMMPVRDNLGCVRYLEFGNVPFTEEIKNYNRERLQERAKFEGRDVSFQMVIDDIFAVGKGRLIGR 481
gi 19713097  402 GVLDVPFAPSKYNLGKMMPARDSEGMIRYLDIGNLPFCPLIEEFHNKKIKERSMKENREINFQMTIDDIFAMSQGKLINK 481
gi 2507035   402 GVMDIPFGPSKYNAGKMMPVRDNLGCVRYLEFGNVPFTEEIKNYNRERLQERAKFEGRDVSFQMVIDDIFAVGKGRLIGR 481
gi 446345465 401 GVLDVPFAPAACNAGKILPVRDNTGAIRVLEAGAVPLPKDILDLHHDYVAERARCEGRQPTFQMVVDDINAVSHSKLIGR 480
gi 499206162 393 GTLDIPFPPSDAAAGDVLPARDDDGRVRLLKFGAVALDDETKRIHRARLDRRADTEGRELSFRMVADDVSAVSDGRLIGR 472

                 .
1CCW_B       482 P 482
gi 19713097  482 K 482
gi 2507035   482 P 482
gi 446345465 481 P 481
gi 499206162 473 P 473
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap