1YB4,1VPD


Conserved Protein Domain Family
tartro_sem_red

?
TIGR01505: tartro_sem_red 
Click on image for an interactive view with Cn3D
2-hydroxy-3-oxopropionate reductase
This model represents 2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60), also called tartronate semialdehyde reductase. It follows glyoxylate carboligase and precedes glycerate kinase in D-glycerate pathway of glyoxylate degradation. The eventual product, 3-phosphoglycerate, is an intermediate of glycolysis and is readily metabolized. Tartronic semialdehyde, the substrate of this enzyme, may also come from other pathways, such as D-glucarate catabolism.
Statistics
?
PSSM-Id: 130569
View PSSM: TIGR01505
Aligned: 5 rows
Threshold Bit Score: 421.22
Threshold Setting Gi: 56554320
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1YB4_A       5 KLGFIGLGIXGSPXAINLARAGHQLHVTTIGP-VADELLSLGAVNVETARQVTEFADIIFIXVPDTPQVEDVLFGEHGCA 83
gi 4455750   6 KVAWIGLGIMGSPMSENLIKAGYQVTGFTLEQeKLDRLAAAGGGVAGSIAEAVRDADVVVTMVPASPQVEAIAYGPDGIL 85
gi 2494062   2 KLGFIGLGIMGTPMAINLARAGHQLHVTTIGp-VADELLSLGAVSVETARQVTEASDIIFIMVPDTPQVEEVLFGENGCT 80
gi 7404486   2 KVGFIGLGIMGKPMSKNLLKAGYSLVVADRNPeAIADVIAAGAETASTAKAIAEQCDVIITMLPNSPHVKEVALGENGII 81
1VPD_A       7 KVGFIGLGIXGKPXSKNLLKAGYSLVVSDRNPeAIADVIAAGAETASTAKAIAEQCDVIITXLPNSPHVKEVALGENGII 86
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1YB4_A      84 KTSLQGKTIVDXSSISPIETKRFAQRVNEXGADYLDAPVSGGEIGAREGTLSIXVGGEQKVFDRVKPLFDILGKNITLVG 163
gi 4455750  86 ENAKSGALLVDMSSITPQTSVDLAKAAKDKGIRVLDAPVSGGEAGAIEAVLSIMVGGEQADFDEAKPLLEALGKTIVLCG 165
gi 2494062  81 KASLKGKTIVDMSSISPIETKRFARQVNELGGDYLDAPVSGGEIGAREGTLSIMVGGDEAVFERVKPLFELLGKNITLVG 160
gi 7404486  82 EGAKPGTVLIDMSSIAPLASREISEALKAKGIDMLDAPVSGGEPKAIDGTLSVMVGGDKAIFDKYYDLMKAMAGSVVHTG 161
1VPD_A      87 EGAKPGTVLIDXSSIAPLASREISDALKAKGVEXLDAPVSGGEPKAIDGTLSVXVGGDKAIFDKYYDLXKAXAGSVVHTG 166
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1YB4_A     164 GNGDGQTCKVANQIIVALNIEAVSEALVFASKAGADPVRVRQALXGGFASSRILEVHGERXINRTFEPGFKIALHQKDLN 243
gi 4455750 166 PHGSGQTVKAANQLIVAVNIQACAEAVVFLEKSGVDLKAALDVLNGGLAGSTVLTRKKDNFLGRDFKPGFRIDLHHKDMG 245
gi 2494062 161 GNGDGQTCKVANQIIVALNIEAVSEALLFASKAGADPVRVRQALMGGFASSRILEVHGERMIKRTFNPGFKIALHQKDLN 240
gi 7404486 162 EIGAGNVTKLANQVIVALNIAAMSEALTLATKAGVNPDLVYQAIRGGLAGSTVLDAKAPMVMDRNFKPGFRIDLHIKDLA 241
1VPD_A     167 DIGAGNVTKLANQVIVALNIAAXSEALTLATKAGVNPDLVYQAIRGGLAGSTVLDAKAPXVXDRNFKPGFRIDLHIKDLA 246
                      250       260       270       280       290
               ....*....|....*....|....*....|....*....|....*....|.
1YB4_A     244 LALQSAKALALNLPNTATCQELFNTCAANGGSQLDHSAXVQALELXANHKL 294
gi 4455750 246 IVTDAARNVGAALPVGAVVAQLVASLRAQGDGGLDHSALLRAVERLSGDQV 296
gi 2494062 241 LALQSAKALALNLPNTATCQELFNTCAANGGSQLDHSALVQALELMANHKL 291
gi 7404486 242 NALDTSHGVGAQLPLTAAVMEMMQALRADGLGTADHSALACYYEKLAKVEV 292
1VPD_A     247 NALDTSHGVGAQLPLTAAVXEXXQALRADGHGNDDHSALACYYEKLAKVEV 297
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap