Conserved Protein Domain Family
ribC_arch

?
TIGR01506: ribC_arch 
riboflavin synthase
This archaeal protein catalyzes the same reaction, the final step in riboflavin biosynthesis, as bacterial riboflavin biosynthesis alpha chain. However, it is more similar in sequence to 6,7-dimethyl-8-ribityllumazine synthase, which catalyzes the previous reaction and which (in bacteria) is called the riboflavin synthase beta chain. [Biosynthesis of cofactors, prosthetic groups, and carriers, Riboflavin, FMN, and FAD]
Statistics
?
PSSM-Id: 130570
View PSSM: TIGR01506
Aligned: 3 rows
Threshold Bit Score: 225.54
Threshold Setting Gi: 9789768
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9789777   3 KVGICDTTFARYDMGGAAIDELKkHTAGIKIIRRTVPGIKDLPVACKKLIEEEGCEMVMALGMPGPEEKDKVCAHEASTG 82
gi 9789754   2 KIGIADTTFSRINMGKIAIDELR-KISSIPYERYTVPGIKDLPIAAKKLLEEKGCDIVITLGWVGGTQKDMLSYIVLSMG 80
gi 9789768   4 CVGVADTTFARVDMGSVAEEVLRrRLPGYRIVRHTVPGIKDLPGAAKRILS-MGCEGVITLGWVGRREADKLSYLAASVG 82
                       90       100       110       120       130       140       150
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 9789777  83 LIQAQLMTNTHILEVFVHEDEEDDPEELKVLADNRAREHAQNLIMMLFKPDR-LTREAGMGLREGKPDAGPL 153
gi 9789754  81 LVIVQLMTNKHVIDVTIHEDEAEDEKTLMMVAENRVREHVRNAVDLLVNPKR-LQKLAGTGQRQGYPDVGPI 151
gi 9789768  83 LIMVEVLTGKIVIDVTVHEDEAEAPEELAAIAVDRARKHAENLAALIREGPEaLVKHAGMGLRQGYPDAGPI 154
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap