2IM5,1VLP


Conserved Protein Domain Family
NAPRTase

?
TIGR01514: NAPRTase 
Click on image for an interactive view with Cn3D
nicotinate phosphoribosyltransferase
This model represents nicotinate phosphoribosyltransferase, the first enzyme in the salvage pathway of NAD biosynthesis from nicontinate (niacin). Members are primary proteobacterial but also include yeasts and Methanosarcina acetivorans. A related family, apparently non-overlapping in species distribution, is TIGR01513. Members of that family differ in substantially in sequence and have a long C-terminal extension missing from this family, but are proposed also to act as nicotinate phosphoribosyltransferase (see model TIGR01513). [Biosynthesis of cofactors, prosthetic groups, and carriers, Pyridine nucleotides]
Statistics
?
PSSM-Id: 130578
View PSSM: TIGR01514
Aligned: 6 rows
Threshold Bit Score: 558.22
Threshold Setting Gi: 52696213
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2IM5_A         3 IIRSILDTDLYKFTTGYAYAKLFPRAYGEFRFIDRNRQg--FTEEFAELVRGEIRAMAALSLTRDEKEFLQReLPYLPPI 80
gi 2507262     5 VIKSLLDTDMYKITMHAAVFTNFPDVTVTYKYTNRSSQl-tFNKEAINWLKEQFSYLGNLRFTEEEIEYLKQeIPYLPSA 83
gi 496703245  21 IIHSLLDTDLYKFTMLQVVLHQFPQTHSLYEFRCRNAStvyPLADIREDLEAELDALCQLRFTHDELGYLRS-LRFIKSD 99
gi 446992333  10 IIRSLLDLDAYKINMMQAIHHFYPDVSVRYELIVRSEE---DASGLLDAIRQEIAHLGTLRFSDADIHYLTQhAPHLKAT 86
gi 130366      8 VLHSLLDTDAYKLHMQQAVFHHYYDVHVAAEFRCRGDD---LLGIYADAIREQVQAMQHLRLQDDEYQWLSA-LPFFKAD 83
1VLP_A        17 VIKSLLDTDXYKITXHAAVFTNFPDVTVTYKYTNRSSQl-tFNKEAINWLKEQFSYLGNLRFTEEEIEYLKQeIPYLPSA 95
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2IM5_A        81 YIDFLD--GFRFDPeE-VTVSi--DA---QG----HLDIRAQGLLYRVTLWETPILAVISELYYRFIGAEPDWKQVEEVT 148
gi 2507262    84 YIKYISssNYKLHPeEqISFTseeIE---GKpthyKLKILVSGSWKDTILYEIPLLSLISEAYFKFVDIDWDYENQLEQA 160
gi 496703245 100 FVDYLE--LFQLQR-RfVEIGt--DD---KD----RLNIRIEGPMIQAMFFEIFILAIVNELYFRRLETPAVIEEGERRL 167
gi 446992333  87 FLQSLR--YFHFVPqEqVEMGi--VKqggKQ----QLRISIRGSWRDTILYETLVMAIVSEVRSRQRWAEVPADLPLKVL 158
gi 130366     84 YLNWLR--EFRFNP-EqVTVS---ND---NG----KLDIRLSGPWREVILWEVPLLAVISEMVHRYRSPQADVAQALDTL 150
1VLP_A        96 YIKYISssNYKLHPeEqISFTseeIE---GKpthyKLKILVSGSWKDTILYEIPLLSLISEAYFKFVDIDWDYENQLEQA 172
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2IM5_A       149 RSK---------GELMREhrATFSIFGMRRRFSLEVEDRVTDILKQYAg-------eSLFGTSNVHLAHKHGLRVSGTHP 212
gi 2507262   161 EKK---------AETLFDngIRFSEFGTRRRRSLKAQDLIMQGIMKAVngnpdrnksLLLGTSNILFAKKYGVKPIGTVA 231
gi 496703245 168 QAKaarlkeiaaAQNPDEppFLISDFGTRRRYKLAWQEHVIRTLLEAAp-------gIVRGTSNVFLAKKLGITPIGTMA 240
gi 446992333 159 KTKldqlkaeieRRGINN--FSLTEMGTRRRFSSQVQRDVLACLKQEIp-------qWVLGTSNYHFAREFDLKPIGTIA 229
gi 130366    151 ESKlvdfsaltaGLDMSR--FHLMDFGTRRRFSREVQETIVKRLQQES---------WFVGTSNYDLARRLSLTPMGTQA 219
1VLP_A       173 EKK---------AETLFDngIRFSEFGTRRRRSLKAQDLIXQGIXKAVngnpdrnksLLLGTSNILFAKKYGVKPIGTVA 243
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2IM5_A       213 HEWIQFHGAIYg-YkMANYVAMEDWINVYDGD-LGTVLTDTYTTDVFMRNFSKKHAMLFTSLRHDSGDPEIFIEKAVRRY 290
gi 2507262   232 HEWVMGVASISedYlHANKNAMDCWINTFGAKnAGLALTDTFGTDDFLKSFRPPYSDAYVGVRQDSGDPVEYTKKISHHY 311
gi 496703245 241 HEFLQAFQALDvrLrNFQKAALESWVHEYRGD-LGVALTDVVGMDAFLRDFDLYFAKLFDGLRHDSGDPYVWGDKAYAHY 319
gi 446992333 230 HEWFMGHQALVne-rDSQQVALERWLTAFDGM-LAIAPTDTLTIDAFLNDFNRHLANAYDGVRHDSGCPFRWGDKMIAHY 307
gi 130366    220 HEWFQAHQQISpdLaNSQRAALAAWLEEYPDQ-LGIALTDCITMDAFLRDFGVEFASRYQGLRHDSGDPVEWGEKAIAHY 298
1VLP_A       244 HEWVXGVASISedYlHANKNAXDCWINTFGAKnAGLALTDTFGTDDFLKSFRPPYSDAYVGVRQDSGDPVEYTKKISHHY 323
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2IM5_A       291 EELRVDPK-IKYIIFSDSLTPQRAIEIQKLCAG-RIKASFGIGTNLTNDVgG--------GVEPLNIVMKLWKCKMTAkd 360
gi 2507262   312 HDVLKLPKfSKIICYSDSLNVEKAITYSHAAKEnGMLATFGIGTNFTNDF-Rkkse-pqvKSEPLNIVIKLLEVNGNH-- 387
gi 496703245 320 QKLKIDSR-TKMLTFSDGLDIERSWALHQYFKD-RFKTGFGIGTNLTNDM-G---------HTPLNIVLKLVECNGQS-- 385
gi 446992333 308 QQLGIDPT-TKLFIFSDGLDFDQALELCEYFAG-RVKISFGIGTFLTNDL-AnwrnaagvEYRPLSIVIKLAECQGRP-- 382
gi 130366    299 EKLGIDPQ-SKTLVFSDNLDLRKAVELYRHFSS-RVQLSFGIGTRLTCDI-P--------QVKPLNIVIKLVECNGKP-- 365
1VLP_A       324 HDVLKLPKfSKIICYSDSLNVEKAITYSHAAKEnGXLATFGIGTNFTNDF-Rkkse-pqvKSEPLNIVIKLLEVNGNH-- 399
                        410       420       430
                 ....*....|....*....|....*....|...
2IM5_A       361 dwhyCVKLSDVDGKHTGEPEEILLAMNTLGIKP 393
gi 2507262   388 ----AIKISDNLGKNMGDPATVKRVKEELGYTE 416
gi 496703245 386 ----VAKLSDSPGKTMTNNSTFLAYLRQVFDVP 414
gi 446992333 383 ----VAKISDQPEKAMCEDPIFLANLKRRFNIE 411
gi 130366    366 ----VAKLSDSPGKTICHDKAFVRALRKAFDLP 394
1VLP_A       400 ----AIKISDNLGKNXGDPATVKRVKEELGYTE 428
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap