1B57


Conserved Protein Domain Family
FruBisAldo_II_A

?
TIGR01520: FruBisAldo_II_A 
Click on image for an interactive view with Cn3D
fructose-bisphosphate aldolase, class II, yeast/E. coli subtype
Members of this family are class II examples of the glycolytic enzyme fructose-bisphosphate aldolase (FBA). This model represents one of two deeply split, architecturally distinct clades of the family that includes class II fructose-bisphosphate aldolases, tagatose-bisphosphate aldolases, and related uncharacterized proteins. This family is well-conserved and includes characterized FBA from Saccharomyces cerevisiae, Escherichia coli, and Corynebacterium glutamicum. Proteins outside the scope of this model may also be designated as class II fructose-bisphosphate aldolases, but are well separated in an alignment-based phylogenetic tree. [Energy metabolism, Glycolysis/gluconeogenesis]
Statistics
?
PSSM-Id: 130583
View PSSM: TIGR01520
Aligned: 6 rows
Threshold Bit Score: 536.327
Threshold Setting Gi: 6686367
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1B57_A       3 IFDFVK--PG-VITGDDVQKVFQVAKENNFALPAVNCVGTDSINAVLETAAKVKAPVIVQFSNGGASFIAGKGVKSDVPQ 79
gi 113620    4 IFDFVK--PG-VITGDDVQKVFQVAKENNFALPAVNCVGTDSINAVLETAAKVKAPVIVQFSNGGASFIAGKGVKSDVPQ 80
gi 6686370   3 VLDKIK--PG-VVYGKELHFLYEICKKEGFAIPSINCIGTNSINAVLEAAKEINSPIMIQFSNSGSAFISGKGLKMEKPQ 79
gi 6686367   1 ----MP-----IATPEVYAEMLGQAKQNSYAFPAINCTSSETVNAAIKGFADAGSDGIIQFSTGGAEFGSGLGVKD---- 67
gi 1334980   5 IPEHKQnlTFsLPLGDDVLKLFQYAREKQFAIPACNVTSSSTAVAALEAARDQKAPSSLQTSQGCAAFFAGKGIKDSAEK 84
gi 113626    3 VEQILKrkTG-VIVGEDVHNLFTYAKEHKFAIPAINVTSSSTAVAALEAARDSKSPIILQTSNGGAAYFAGKGISNEGQN 81
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1B57_A      80 Ga-AILGAISGAHHVHQMAEHYGVPVI-LHTDHCAKKLLp-WIDGLLDAGEKHFAATGKPLFSSHMIDLSEESLQENIEI 156
gi 113620   81 Ga-AILGAISGAHHVHQMAEHYGVPVI-LHTDHCAKKLLp-WIDGLLDAGEKHFAATGKPLFSSHMIDLSEESLQENIEI 157
gi 6686370  80 Gv-SIVGAISGAMHVHLMAEHYGVPVV-LHTDHCAKNLLp-WVEGLLEYGEKYYSQHKKPLFSSHMLDLSEEPIKENIEI 156
gi 6686367  68 ---MVTGAVALAEFTHVIAAKYPVNVA-LHTDHCPKDKLdsYVRPLLAISAQRVSKGGNPLFQSHMWDGSAVPIDENLAI 143
gi 1334980  85 ArdSVAGAIAAAHYIRSIAPIYGIPVVrIHTDHCAKKLL--FGDGIPEEDEKFFKANGVPLFSSHMIDLSEEPVEENIST 162
gi 113626   82 A--SIKGAIAAAHYIRSIAPAYGIPVV-LHSDHCAKKLLp-WFDGMLEADEAYFKEHGEPLFSSHMLDLSEETDEENIST 157
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1B57_A     157 CSKYLERMSKIGMTLEIELGCTGGEEDGVDNSHMDASALYTQPEDVDYAYTELSK-ISPRFTIAASFGNVHGVYkPGNVV 235
gi 113620  158 CSKYLERMSKIGMTLEIELGCTGGEEDGVDNSHMDASALYTQPEDVDYAYTELSK-ISPRFTIAASFGNVHGVYkPGNVV 236
gi 6686370 157 SKKFLERMAKIEMFLEIELGITGGEEDGVDNSDRALHELFSTPEDIYYGYSELLK-VSPNFQIAAAFGNVHGVYkPGNVK 235
gi 6686367 144 AQELLKAAAAAKIILEIEIGVVGGEEDGVANEIN--EKLYTSPEDFEKTIEALGAgEHGKYLLAATFGNVHGVYkPGNVK 221
gi 1334980 163 CVKYLKRMAPMKQWLEMEIGITGGEEDGVDNSEVDNASLYTQPEDIWQIEEDSRP-ISPYFSIGAGFGNVHGVYaPGNVK 241
gi 113626  158 CVKYFKRMAAMDQWLEMEIGITGGEEDGVNNENADKEDLYTKPEQVYNVYKALHP-ISPNFSIAAAFGNCHGLY-AGDIA 235
                      250       260       270       280       290       300       310       320
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1B57_A     236 LTPTILRDSQEYVSKKHNLP--HNSLNFVFHGGSGSTAQEIKDSVSYGVVKMNIDTDTQWATWEGVLNYYKANEAYLQGQ 313
gi 113620  237 LTPTILRDSQEYVSKKHNLP--HNSLNFVFHGGSGSTAQEIKDSVSYGVVKMNIDTDTQWATWEGVLNYYKANEAYLQGQ 314
gi 6686370 236 LTPKVLKDGQDYVISKTGVNm-AKPVSYVFHGGSGSTIDEINEALSYGVVKMNIDTDTQWAAWEGVLNYYKKNESRLQGQ 314
gi 6686367 222 LRPDILAQGQQVAAAKLGLPadAKPFDFVFHGGSGSLKSEIEEALRYGVVKMNVDTDTQYAFTRPIAGHMFTNYDGVLKV 301
gi 1334980 242 LHPDLLGKQQAYVPEKLGGKd-KKPFFFVFHGGSGSSKEEYREAISNGVVKVNVDTDLQWSYLVGIRDYILNNIDYLRSQ 320
gi 113626  236 LRPEILAEHQKYTREQVGCKe-EKPLFLVFHGGSGSTVQEFHTGIDNGVVKVNLDTDCQYAYLTGIRDYVLNKKDYIMSP 314
                      330       340       350       360
               ....*....|....*....|....*....|....*....|....*
1B57_A     314 LGNPKGEDQPNKKYYDPRVWLRAGQTSMIARLEKAFQELNAIDVL 358
gi 113620  315 LGNPKGEDQPNKKYYDPRVWLRAGQTSMIARLEKAFQELNAIDVL 359
gi 6686370 315 LGDGKDIDIPNKKFYDPRVWLREAEVSMKDRVKIACKNLNNINRN 359
gi 6686367 302 DG-----EVGVKKVYDPRSYLKKAEASMSQRVVQACNDLHCAGKS 341
gi 1334980 321 VGNPEGPNKPNKKKYDPRVWIREGEKTMKARVEEGPQGPSNTTVT 365
gi 113626  315 VGNPEGPEKPNKKFFDPRVWVREGEKTMGAKITKSLETFRTTNTL 359
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap