Conserved Protein Domain Family
ATPase-IIA2_Ca

?
TIGR01522: ATPase-IIA2_Ca 
golgi membrane calcium-translocating P-type ATPase
This model describes the P-type ATPase responsible for translocating calcium ions across the golgi membrane of fungi and animals, and is of particular importance in the sarcoplasmic reticulum of skeletal and cardiac muscle in vertebrates. The calcium P-type ATPases have been characterized as Type IIA based on a phylogenetic analysis which distinguishes this group from the Type IIB PMCA calcium pump modelled by TIGR01517. A separate analysis divides Type IIA into sub-types, SERCA and PMR1, the former of which is modelled by TIGR01116.
Statistics
?
PSSM-Id: 130585
View PSSM: TIGR01522
Aligned: 4 rows
Threshold Bit Score: 1570.21
Threshold Setting Gi: 19111890
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6321271   35 SLEYCTLSVDEALEKLDTDKNGGLRSSNEANNRRSLYGPNEITVEDDESLFKKFLSNFIEDRMILLLIGSAVVSLFMGNI 114
gi 19111890   2 SVQYDAFSVEQTCADLETDMYNGLSSLQEITRRNKVHGDNDLKVEDEENMVVQFLKQFVKDPLILLLFASSAISVTLGNI 81
gi 50552652  24 SAQYCQMTVEETCSKLQTNPETGLTSSQEAMHRRDIHGSNEFAQEEEDSLIKKFFEQFSENPLLLLLIGAAAVSFFMGNH 103
gi 6715131   23 SKKASELPVSEVASILQADLQNGLN-KCEVSHRRAFHGWNKFDISEDEPLWKKYISQF-KNPLIMLLLASAVISVLMHQF 100
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6321271  115 DDAVSITLAIFIVVTVGFVQEYRSEKSLEALNKLVPAECHLMRCGQESHVLASTLVPGDLVHFRIGDRIPADIRIIEAID 194
gi 19111890  82 DDAISIALAIVIVVTVGFVQEYRSEQSLKALNNLVPHYCNVIRSGKTEHIVASKLVPGDLVILQIGDRVPADLRIVEATE 161
gi 50552652 104 DDAISITLAILIVTTVGFVQEYRSEKSLEALNKLVPPEAHLIRAGNSQTVLASTLVPGDLVEFSVGDRIPADCRIVKAVH 183
gi 6715131  101 DDAVSITVAILIVVTVAFVQEYRSEKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVD 180
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6321271  195 LSIDESNLTGENEPVHKTSQTIEKssfndqpnsivpISERSCIAYMGTLVKEGHGKGIVVGTGTNTSFGAVFEMMNNIEK 274
gi 19111890 162 LEIDESNLTGENSPRKKSSEAISSni---------sLTERNNIAFMGTLVRHGHGRGIVVATGSDTEFGRVFLTMQQTEK 232
gi 50552652 184 LSIDESNLTGETTPVTKDTNPVTGtpp-------igLADRTNTAYMGTLVRDGNGTGIVVGTGSHTAFGAVYDMVSEIST 256
gi 6715131  181 LSIDESSLTGETTPCSKVTAPQPAatn-------gdLASRSNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEA 253
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6321271  275 PKTPLQLTMDKLGKDLSLVSFIVIGMICLVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVR 354
gi 19111890 233 PKTPLQNSMDDLGKQLSLISLIGIAVIVLVGFFQGKNWLEMLTIGVSLAVAAIPEGLPIIVTVTLALGVLRMSKKRAIIR 312
gi 50552652 257 PKTPLQASMDNLGKDLSLVSFGVIGVICLIGMFQGRDWLEMFTIGVSLAVAAIPEGLPIIVTVTLALGVLRMSRQKAIVR 336
gi 6715131  254 PKTPLQKSMDLLGKQLSFYSFGIIGIIMLVGWLLGKDILEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVK 333
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6321271  355 RLPSVETLGSVNVICSDKTGTLTSNHMTVSKLWCLDsmsnK---LNVLSL------------------Dknkktknsngn 413
gi 19111890 313 RLPSVETLGSVNVICSDKTGTLTMNHMTVTKIYTCG----M---LAAFSL------------------Pesehie----- 362
gi 50552652 337 KLPSVETLGSVNVICSDKTGTLTRNHMSCTTCWTVD----MgdlANAVTLkpgqshteadpkavaalkN----------- 401
gi 6715131  334 KLPIVETLGCCNVICSDKTGTLTKNEMTVTHIFTSDglhtE---VTGVGY------------------Nqfgevivdgdv 392
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6321271  414 lknylTEDVRETLTIGNLCNNASFSQEHAIFLGN-------PTDVALLEQLANFEMPDIRNTVQKVQELPFNSKRKLMAT 486
gi 19111890 363 lsvrrTVGIEKALLAAALCNNSKVHNKADSILDTtcpwagfPVDVALIECSERFGLKDPRETYSRISEVSFSSERKYMSV 442
gi 50552652 402 -----SVSLANMLKVGNLCNNSKFNREAGHLVGN-------ATDIALIEVLDYFGLEDTRETRKRVAEVPFSSSRKWMLT 469
gi 6715131  393 vhgfyNPAVSRIVEAGCVCNDAVIRNN--TLMGK-------PTEGALIALAMKMGLDGLQQDYIRKAEYPFSSEQKWMAV 463
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6321271  487 KILNp--vDNK--CTVYVKGAFERILEYSTSYLKSKGKkTEKLTEAQKATINECANSMASEGLRVFGFAKLTLsdsstpl 562
gi 19111890 443 AVQY----NSS--KMNFMKGATEQVLSSCAYFSDQDGV-QHELTAEMKENIQRNEFEMAASGLRIIAVASGIN------- 508
gi 50552652 470 STTT----GDSstPMISVKGAGEVIAPFCEYYCKKDGK-TAPFNDDMRKKVTEIASEMSNDGLRIIAFAYKQG------- 537
gi 6715131  464 KCVHrtqqDRP--EICFMKGAYEQVIKYCTTYQSK-GQ-TLTLTQQQRDVYQQEKARMGSAGLRVLALASGPE------- 532
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6321271  563 tedliKD----------LTFTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTAVNIAKQIGIPVIDPKlsvlS- 631
gi 19111890 509 -----TNk---------LVFHGLFGINDPPRPQVRESVQYLMTGGVRVIMITGDSVVTAISIARSLGMAIPSND----Ee 570
gi 50552652 538 -----KYeegseeapegLVFAGLMGLYDPPRPDVPRAIRRLTTGGVRVVMITGDSAATALSIGRRIGMPLMPGT----Qs 608
gi 6715131  533 -----LGq---------LTFLGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRLGLYSKTSQ----Sv 594
                       650       660       670       680       690       700       710       720
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6321271  632 --------GDKLDEMSDDQLANVIDHVNIFARATPEHKLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTD 703
gi 19111890 571 airnyaltGAQLDDLDSSSLRDAVSRVVVFARTTPQHKMKIVEALQSLGDVVAMTGDGVNDAPALKLADIGIAMGRQGTD 650
gi 50552652 609 v-----veGSKLATMSDQALDECLQTASIFARTSPEDKMKIVKGFQRRGDVVAMTGDGVNDAPALKLADIGIAMGQGGTD 683
gi 6715131  595 -------sGEEIDAMDVQQLSQIVPKVAVFYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMGQTGTD 667
                       730       740       750       760       770       780       790       800
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6321271  704 VAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVALSTAFKLPNPLNAMQILWINILMDGPPAQ 783
gi 19111890 651 VAKEAADMILTDDSFATILSAVEEGKGIFNNIKNFITFQLSTSVAALSLIAISSVFGFQNPLNAMQILWINILMDGPPAQ 730
gi 50552652 684 VAKEAADMILTDDDFATILSAIEEGKGIFNNIRNFITFQLSTSMAALSIVAVATIMGLENPLNPMQILWINILMDGPPAQ 763
gi 6715131  668 VCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVRFQLSTSIAALTLISLATLMNFPNPLNAMQILWINIIMDGPPAQ 747
                       810       820       830       840       850       860       870       880
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6321271  784 SLGVEPVDHEVMKKPPRKRTDKILTHDVMKRLLTTAACIIVGTVYIFVKEMAeDGKVTARDTTMTFTCFVFFDMFNALAC 863
gi 19111890 731 SLGVESVDEDVMMKPPRPRNAPIISVQLLQRVLLSAFIIVTVTIVVFRVQMQ-DGNVTARDTTMTFTCFVFFDMFNALAC 809
gi 50552652 764 SLGVEPVDPDVMNKPPRPRNEKVMTPDLVKKCVEAAVIILVGTMLVYVTQMQ-DGVIDKRDTTMTFTCFVFYDMFNALAC 842
gi 6715131  748 SLGVEPVDKDVIRKPPRNWKDSILTKNLILKILVSSIIIVCGTLFVFWRELR-DNVITPRDTTMTFTCFVFFDMFNALSS 826
                       890       900       910       920       930       940       950
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 6321271  864 RHNTKSIFEIGFFTNKMFNYAVGLSLLGQMCAIYIPFFQSIFKTEKLGISDILLLLLISSSVFIVDELRKLWTRKKN 940
gi 19111890 810 RSETKSVFKLGIFSNRMFNIAVGGSLIGQALVVYASPFQRIFQTEAIGLKDVLILLACTSSVLWVDEIRKWYRRRKG 886
gi 50552652 843 RSATKSVFEIGFFSNKMFLYACGASIIGQLAVVYVPFLQSVFQTEALSVKDLLSLVLISSSVWILDEAKKYFLKSRS 919
gi 6715131  827 RSQTKSVFEIGLCSNRMFCYAVLGSIMGQLLVIYFPPLQKVFQTESLSILDLLFLLGLTSSVCIVAEIIKKVERSRE 903
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap