Conserved Protein Domain Family
ATPase-IID_K-Na

?
TIGR01523: ATPase-IID_K-Na 
potassium and/or sodium efflux P-type ATPase, fungal-type
Initially described as a calcium efflux ATPase, more recent work has shown that the S. pombe CTA3 gene is in fact a potassium ion efflux pump. This model describes the clade of fungal P-type ATPases responsible for potassium and sodium efflux. The degree to which these pumps show preference for sodium or potassium varies. This group of ATPases has been classified by phylogentic analysis as type IID. The Leishmania sequence (GP|3192903), which falls between trusted and noise in this model, may very well turn out to be an active potassium pump.
Statistics
?
PSSM-Id: 130586
View PSSM: TIGR01523
Aligned: 2 rows
Threshold Bit Score: 1924.78
Threshold Setting Gi: 19112038
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6320245    11 NAEFNAYHTLTAEEAAEFIgTSLTEGLTQDEFVHRLKTVGENTLGDDTKIDYKAMVLHQVCNAMIMVLLISMIISFAMHD 90
gi 19112038    5 NISNPVYFSDIKDVESEFL-TSIPNGLTHEEAQNRLSEYGENRLEADSGVSAWKVLLRQVLNAMCVVLILAAALSFGTTD 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6320245    91 WITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETK 170
gi 19112038   84 WIEGGVISAIIVLNITVGFIQEYKAEKTMDSLRTLASPMAHVTRSSKTDAIDSHLLVPGDVVVLKTGDVVPADLRLVETV 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6320245   171 NFDTDESLLTGESLPVSKDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISR- 249
gi 19112038  164 NFETDEALLTGESLPVIKDAHATFQMNEDVPIGDRINLAYSSSIVTKGRAKGICYATGMQTQIGAIAAGLRQKGKLFQRp 243
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6320245   250 ---DPSKSWLQNTWIS--TKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFDVDKRVAIYAICVALSM 324
gi 19112038  244 ekdEPNYRRKLNKYYLkvTSYYVQRVLGLNVGTPLQRKLTVLAYILFCIAIILAIIVMAAHSFHVTNEVSIYAISLGISI 323
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6320245   325 IPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSdDPFNPN 404
gi 19112038  324 IPESLIAVLSITMAMGQKNMSKRRVIVRKLEALEALGGVTDICSDKTGTITQGKMITRRVWIPSYGYLSVDTS-DANNPT 402
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6320245   405 EGNVSLIprfspyeyshnEDGDVGILQNFKDRLYEKDlPEDIDMDLFQKWLETATLANIATVFkDDATDCWKAHGDPTEI 484
gi 19112038  403 IGTVSGL-----------EAAMQDVLKEKKQEMKNID-PSNQPSDQFIPLLKTCALCNLSTVN-QTETGEWVVKGEPTEI 469
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6320245   485 AIQVFATKMDLphnaltGEKSTNQSNEndqsslsqhnekpgsaqfeHIAEFPFDSTVKRMSSVYYNNHNEtYNIYGKGAF 564
gi 19112038  470 ALHVFSKRFNY------GKEDLLKTNT-------------------FVREYPFDSEIKRMAVIYEDQQGQ-YTVYAKGAV 523
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6320245   565 ESIISCCSSWYGkdgvkiTPLTDCDVETIRKNVYSLSNEGLRVLGFASKSFTKDQVNddqlknITSNRATAESDLVFLGL 644
gi 19112038  524 ERILERCSTSNG------STLEEPDRELIIAQMETLAAEGLRVLALATKVIDKADNW------ETLPRDVAESSLEFVSL 591
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6320245   645 IGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTnLYHYSQEIVDSMVMTGSQFDGLSEEEVDDLP 724
gi 19112038  592 VGIYDPPRTESKGAVELCHRAGIRVHMLTGDHPETAKAIAREVGIIPP-FISDRDPNMSWMVMTGSQFDALSDEEVDSLK 670
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6320245   725 VLPLVIARCSPQTKVRMIEALHRRKKFCTMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEE 804
gi 19112038  671 ALCLVIARCAPQTKVKMIEALHRRKAFVAMTGDGVNDSPSLKQANVGIAMGQNGSDVAKDASDIVLTDDNFSSIVNAIEE 750
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6320245   805 GRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDENGKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPHDS 884
gi 19112038  751 GRRMFDNIMRFVLHLLVSNVGEVILLVVGLAFRDEVHLSVFPMSPVEILWCNMITSSFPSMGLGMELAQPDVMERLPHDN 830
                        890       900       910       920       930       940       950       960
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6320245   885 EVGIFTWEVIIDTFAYGIIMTGSCMASFTGSLYGINSGRLGHDCDGTYNSSCRDVYRSRSAAFATMTWCALILAWEVVDM 964
gi 19112038  831 KVGIFQKSLIVDMMVYGFFLGVVSLMTWVVIMYGFGTGNLSYDCNAHYHAGCNDVFKARSAVFAVVTFCILIMAVEVKNF 910
                        970       980       990      1000      1010      1020      1030      1040
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6320245   965 RRSFFRMH--PDTDSPVKEFFRSIWGNQFLFWSIIFGFVSAFPVVYIPVINDKVFLHKPIGAEWGLAIAFTIAFWIGAEL 1042
gi 19112038  911 DNSLFNLHgiPWGEWNFRYFLHTLVENKFLAWAIALAAVSVFPTIYIPVINRDVFKHTYIGWEWGVVAVAVMFYFFYVEI 990
                       1050
                 ....*....|...
gi 6320245  1043 YKCGKRRYFKTQR 1055
gi 19112038  991 WKSIRRSLTNPQK 1003
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap