1F9N,3ERE


Conserved Protein Domain Family
argR_whole

?
TIGR01529: argR_whole 
Click on image for an interactive view with Cn3D
arginine repressor
This model includes most members of the arginine-responsive transcriptional regulator family ArgR. This hexameric protein binds DNA at its amino end to repress arginine biosyntheis or activate arginine catabolism. Some species have several ArgR paralogs. In a neighbor-joining tree, some of these paralogous sequences show long branches and differ significantly in an otherwise well-conserved C-terminal region motif GT[VIL][AC]GDDT. These paralogs are excluded from the seed and score in the gray zone of this model, between trusted and noise cutoffs. [Amino acid biosynthesis, Glutamate family, Regulatory functions, DNA interactions]
Statistics
?
PSSM-Id: 130592
View PSSM: TIGR01529
Aligned: 11 rows
Threshold Bit Score: 174.823
Threshold Setting Gi: 8134310
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1F9N_A         4 GQRHIKIREIITSNEIETQDELVDMLKQDGYK-VTQATVSRDIKELHLVKVPTNNG-SYKYSLPADQ-----RFNPLSKL 76
gi 8134309     6 KRRQELIRKIIHEKKISNQFQIVEELKKYGIK-AVQPTVARDLKEIGAVKIMDESG-NYVYKLLDETp----VIDPWKEL 79
gi 113535      4 GQRHIKIREIITSNEIETQDELVDMLKQDGYK-VTQATVSRDIKELHLVKVPTNNG-SYKYSLPADQ-----RFNPLSKL 76
gi 3913094     4 RDRHQLIKKMITEEKLSTQKEIQDRLEAHNVC-VTQTTLSRDLREIGLTKVKKNDM-VY-YVLVN--------ETEKIDL 72
gi 114148      8 EELVKAFKALLKEEKFSSQGEIVAALQEQGFDnINQSKVSRMLTKFGAVRTRNAKM-EMVYCLPAEL------GVPTTSS 80
gi 8134310     5 VTIDEALKEILRLEGAATQEELCAKLLAQGFA-TTQSSVSRWLRKIQAVKVAGERG--ARYSLPSST----------EKT 71
gi 3913089    19 AGRQARIVAILSSAQVRSQNELAALLAAEGIE-VTQATLSRDLEELGAVKLRGADGgTGIYVVPEDGspvrgVSGGTDRM 97
gi 499189847  23 DQRQKRIQDIILRESVSTQAELVKLLAKEGVQ-VTQATVSRDINELRLVRVPIGKG-RHRYALAQYGg----DSDIEEQL 96
gi 489072213   4 MERQQQIKRIIQAEHIGTQEDIKNHLQKEGIV-VTQATLSRDLREIGLLKLRDEQG-KLYYSLS---------EPVATPF 72
3ERE_D        19 AGRQARIVAILSSAQVRSQNELAALLAAEGIE-VTQATLSRDLEELGAVKLRGADGgTGIYVVPEDGspvrgVSGGTDRM 97
gi 490374886   4 DKRLEIIKEIVTNNKISTQEELQSLLLERGVE-VTQATLSRDIRKLNIIKKRDKGE-SF-YSFLTSG-----NSKINSDL 75
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
1F9N_A        77 KRALMDAFVKIDSASHMIVLKTMPGNAQAIGALMDNLDW--DEMMGTICGDDTILIICRTPEDTEGVKNRLLELL 149
gi 8134309    80 KRNFKSFVESIDRAGNLIVIKTIPGTASGIARVIDRLDI--DEIVGTLAGDDTIFVAVRDPESCEKIVEKLSSIL 152
gi 113535     77 KRALMDAFVKIDSASHMIVLKTMPGNAQAIGALMDNLDW--DEMMGTICGDDTILIICRTPEDTEGVKNRLLELL 149
gi 3913094    73 VEFLSHHLEGVARAEFTLVLHTKLGEASVLANIVDVNKD--EWILGTVAGANTLLVICRDQHVAKLMEDRLLDLM 145
gi 114148     81 --PLKNLVLDIDYNDAVVVIHTSPGAAQLIARLLDSLGKa-EGILGTIAGDDTIFTTPANGFTVKDLYEAILELF 152
gi 8134310    72 --TTRHLVLSIRHNASLIVIRTVPGSASWIAALLDQGLK--DEILGTLAGDDTIFVTPIDEGRLPLLMVSIANLL 142
gi 3913089    98 ARLLGELLVSTDDSGNLAVLRTPPGAAHYLASAIDRAAL--PQVVGTIAGDDTILVVAREPTTGAQLAGMFENLR 170
gi 499189847  97 ARLFQSFVQDVDRGENILVIRTADGHASGVALLLDRWKR--DDIVGTLAGEDTIMVVARSTHDGESLMEEFNALM 169
gi 489072213  73 SPEVRFYVLKVDRAGFMLVLHTNLGEADVLANLIDNDAI--EDILGTIAGADTLLVICRDEEIAKRFEKDLAAGL 145
3ERE_D        98 ARLLGELLVSTDDSGNLAVLRTPPGAAHYLASAIDRAAL--PQVVGTIAGDDTILVVAREPTTGAQLAGMFENLR 170
gi 490374886  76 QLYFYNFVISAKSVGALVVIRTKLGEADVLANALDDERDsrTDILGTIAGADTLLVICASEKAANILTAEIKYIL 150
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap