2X5J


Conserved Protein Domain Family
E4PD_g-proteo

?
TIGR01532: E4PD_g-proteo 
Click on image for an interactive view with Cn3D
erythrose-4-phosphate dehydrogenase
This model represents the small clade of dehydrogenases in gamma-proteobacteria which utilize NAD+ to oxidize erythrose-4-phosphate (E4P) to 4-phospho-erythronate, a precursor for the de novo synthesis of pyridoxine via 4-hydroxythreonine and D-1-deoxyxylulose. This enzyme activity appears to have evolved from glyceraldehyde-3-phosphate dehydrogenase, whose substrate differs only in the lack of one carbon relative to E4P. Accordingly, this model is very close to the corresponding models for GAPDH, and those sequences which hit above trusted here invariably hit between trusted and noise to the GAPDH model (TIGR01534). Similarly, it may be found that there are species outside of the gamma proteobacteria which synthesize pyridoxine and have more than one aparrent GAPDH gene of which one may have E4PD activity - this may necessitate a readjustment of these models. Alternatively, some of the GAPDH enzymes may prove to be bifunctional in certain species. [Biosynthesis of cofactors, prosthetic groups, and carriers, Pyridoxine]
Statistics
?
PSSM-Id: 130595
View PSSM: TIGR01532
Aligned: 4 rows
Threshold Bit Score: 622.299
Threshold Setting Gi: 49086700
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2X5J_O         4 RVAINGFGRIGRNVVRALYESGRRAEITVVAINELADAAGMAHLLKYDTSHGRFAWEVRQERDQLFVGD-----DAIRVL 78
gi 120648      4 RVAINGFGRIGRNVVRALYESGRRAEITVVAINELADAAGMAHLLKYDTSHGRFAWEVRQERDQLFVGD-----DAIRVL 78
gi 487840871   4 RVAINGFGRIGRNVLRAVYESGKRDRIQVVAVNELAKPDAMAHLLQYDTSHGRFGKKISHDQQHIYVHHqngeyDSIRIL 83
gi 49086700    7 RVALNGYGRIGRCVLRALHERPEQLGFEIVALNDLADQASVEYLTRFDSTHGRFPGEVKVDGDCLHING-----DCVKVL 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2X5J_O        79 HERSLQSLPWRELGVDVVLDCTGVYGSREHGEAHIAAGAKKVLFSHPGSN--DLDATVVYGVNQDQLRAEHRIVSNASCT 156
gi 120648     79 HERSLQSLPWRELGVDVVLDCTGVYGSREHGEAHIAAGAKKVLFSHPGSN--DLDATVVYGVNQDQLRAEHRIVSNASCT 156
gi 487840871  84 HLSEIPLLPWRDLGVDLVLDCTGVYGCQEDGQQHIDAGAKLVLFSHPGAS--DLDNTIIYGVNHETLTAEHKIVSNGSCT 161
gi 49086700   82 RSPTPEAIDWQALRVDLVLECSGQYTNRAQAERFLRAGAPRVLFSQPMASeaDIDATIVYGVNQQDLSGRETLVSNASCT 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2X5J_O       157 TNCIIPVIKLLDDAYGIESGTVTTIHSAMHDQQVIDAYHP-DLRRTRAASQSIIPVDTKLAAGITRFFPQFNDRFEAIAV 235
gi 120648    157 TNCIIPVIKLLDDAYGIESGTVTTIHSAMHDQQVIDAYHP-DLRRTRAASQSIIPVDTKLAAGITRFFPQFNDRFEAIAV 235
gi 487840871 162 TNCIVPIIKVLDDAFGIDSGTITTIHSSMNDQQVIDAYHN-DLRRTRAASQSIIPVDTKLHKGIERIFPKFSNKFEAISV 240
gi 49086700  162 TNCGVPLLKLLNEAIGLEYVSITTIHSAMNDQPVIDAYHHeDLRRTRSAFQSVIPVSTGLARGIERLLPELAGRIQAKAI 241
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2X5J_O       236 RVPTINVTAIDLSVTVKKPVKANEVNLLLQKAAQ-GAFHGIVDYTELPLVSVDFNHDPHSAIVDGTQTRVSGAHLIKTLV 314
gi 120648    236 RVPTINVTAIDLSVTVKKPVKANEVNLLLQKAAQ-GAFHGIVDYTELPLVSVDFNHDPHSAIVDGTQTRVSGAHLIKTLV 314
gi 487840871 241 RVPTVNVTAMDLSVTIKSNVKVNDVNQTIVNASQ-CTLRGIVDYTEAPLVSIDFNHDPHSAIVDGTQTRVSNGQLVKMLV 319
gi 49086700  242 RVPTVNVSALDITLQTSRDTSAAEINRVLREAAEsGPLRGLLAYTELPHASCDFNHDPHSAIVDGSQTRVSGPRLVNLLA 321
                        330
                 ....*....|....
2X5J_O       315 WCDNEWGFANRMLD 328
gi 120648    315 WCDNEWGFANRMLD 328
gi 487840871 320 WCDNEWGFANRMLD 333
gi 49086700  322 WFDNEWGFANRMLD 335
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap