Conserved Protein Domain Family
A118_put_portal

?
TIGR01542: A118_put_portal 
phage portal protein, putative, A118 family
This model represents a family of phage minor structural proteins. The protein is suggested to be the head-tail connector, or portal protein, on the basis of its position in the phage gene order, its presence in mature phage, its size, and its conservation across a number of complete genomes of tailed phage that lack other candidate portal proteins. Several other known portal protein families lack clear homology to this family and to each other. [Mobile and extrachromosomal element functions, Prophage functions]
Statistics
?
PSSM-Id: 130605
View PSSM: TIGR01542
Aligned: 3 rows
Threshold Bit Score: 771.389
Threshold Setting Gi: 5823601
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16156196  15 KYVMTTQSLTNITDHPKIAISKLEYDRITTNLKYYKSDWDSVLYLN--TDGETKKRDLNHLPIARTAAKKIASLVFNEQA 92
gi 623061    16 AAVGMTKSLGQIIDDPRINLPADEVERIARDKRYYMDDFKQVTHKN--SYGDTQKHELQSVNVTKLASAKLASLIFNEQC 93
gi 5823601   14 RRMGLLKALKDVKDHKKVNANDEDYKYIDMWKRLYQGHYAEWHNLNyeHNGNPVNRRQLSMNLPKVTAKYMSKLLFNEKV 93
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16156196  93 EIKVDDDAANEFISETLKNDRFNKNFERYLESCLALGGLAMRPYVDGDK-VRVAFVQAPVFLPLQSNTQDVSSAAVVIKS 171
gi 623061    94 QVTVSDETANDFLDDVFQQNDFYTTFEEKLEEWIALGSGCVRPYVDSGK-IKLAWATADQVYPLQADTNQVNELAIASRT 172
gi 5823601   94 KINIDDKAAEEFVLNVLKTNGFTKNMERYIEYGEAMGGFVIKVYHDGNKnVKVSFATADCMYPLSNDSENVDECVIAN-- 171
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16156196 172 VKTINGKEVYYTLIEFHEWqSSDDYVISNELYRSDDKAKVGSRVPLS--EVYKDLKDEAKVTDVTRPIFTYLKTPGMNNK 249
gi 623061   173 TEVENHRTIYYTLLEFHQW-DHGDYVITNELYRSEAAETVGINVPLNslEQYEGLEPQVKITGLKHPLFAFYRNKGANNK 251
gi 5823601  172 --SFHKNNKYYTLLEWNEWqG-DVYTVTTELYQSDDPNELGTKVSLT--LLFDDIEPVVPLPDFTRPTFIYIKPNIANNK 246
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16156196 250 DINSPLGLSIFDNAKTTIDFINTTYDEFMWEVKMGQRRVAVPESLTALTVR-TTDGDVVPRPRFESDQNVYIRMGGr-DL 327
gi 623061   252 NFTSPMGMSLIDNSYTVIDAINRTHDQFVDEVKKGQRRLIVPAEWLKTGSSyGGQASETHPPMFDPDETVYQAMYG--DA 329
gi 5823601  247 NLTSPLGISVYANALDTLKTLDLMFDSYYQEFKLGKKKVLVPSSFVKTAVN----LDGSTTQYFDSTDEAFFLYQGdqDD 322
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16156196 328 DSSAIQDLTTPIRADDYIKAINEGLSLFEMQIGVSAGLFSFDGKSMKTATEIVSENSDTYQMRNSIVALVEQSLKELVIS 407
gi 623061   330 SEVGFHDATSPIRVADYQATMDFFLREFENQTGLSQGTFTTSPSGIQTATEVVTNNSQTYQTRSSYITQVEKTIKALTYA 409
gi 5823601  323 NGKAIKDISVEIRSTEFIESINAMLRIYAMQVGLSAGTFTFDENGLKTATEVVSEKSETYQTKNSHSQLIEQGIKEMIVS 402
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16156196 408 IFEIAKAYDLYQSEVP----SMDN--ISISLDDGVFTDRDAELDYWIKVVNAGFGTREMAIQKVLNVTEEKAQEIAAEIN 481
gi 623061   410 ILELASVPSFYADGQArwtgDVDSldITINFNDGVFVDQESKRAADLQAVQAQVMPKKQFLMRNYGLDEEEADEWLAQID 489
gi 5823601  403 ILEVGKFIEAYSGEVV----ELDT--ITVDFDDSIAQDEDTTINRYTNAKNQGMIPLKIALQRAWNITEAEADEWAEMLA 476

                ....*....
gi 16156196 482 TGIVDEINQ 490
gi 623061   490 AENSTAEPE 498
gi 5823601  477 KEKQAEMPN 485
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap