Conserved Protein Domain Family
phge_rel_HI1409

?
TIGR01555: phge_rel_HI1409 
phage-related protein, HI1409 family
This model describes an uncharacterized family of proteins found in prophage regions of a number of bacterial genomes, including Haemophilus influenzae, Xylella fastidiosa, Salmonella typhi, and Enterococcus faecalis. Distantly related proteins can be found in the prophage-bearing plasmids of Borrelia burgdorferi. [Mobile and extrachromosomal element functions, Prophage functions]
Statistics
?
PSSM-Id: 130618
View PSSM: TIGR01555
Aligned: 3 rows
Threshold Bit Score: 602.296
Threshold Setting Gi: 29376023
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1175784     5 DGIKSLALKLGSKQDQTYYAR-GLSLTDDLM--QIEALWRDNWIANKVCIKRSEDMVRNWRDIFSnDLKSEQLDEFTKLE 81
gi 499196529  29 DTLQNLVAGLGDQRDKMSYGRyLLPRVIDRV--ELEAMYRTNWLARKVVDIPATDMTREWVTLQT-CMQADALEPMYRLE 105
gi 488330615  17 AYRNDFMLGNGKGHARDNLSRqRPGTSKRLScsQLESLYSSNSMAKNIVDIPAEDLTRNGWSLK--MQDDKVKALYESKL 94
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1175784    82 RRLKLRETLTKALQWSSLYGAVGLLVVTDTINITSPLQPTER----LKRLIILPKWK-I-SPTGQRDDDVFSPNFGRYSE 155
gi 499196529 106 QALNVRAKVRDALAWARLYGGAVLFINVHGQDPSLPFDPASVmpgsRLSLTVLDRWRvA-LGSGQMDQDPLSETYGQPRC 184
gi 488330615  95 RQLKAKERLQQLFTYERLYGDGFVSIGTIEKREYSLSEPLDFe--nIKSVPYINAFSgKkISNRIIDEDVFSPNYGQIES 172
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1175784   156 YTITGGt------qSVSVHHSRLLIINANDAP-----LSDNDIWGVSDLEKIIDVLKRFDSASANVGDLIFESKIDIFKI 224
gi 499196529 185 YQIAGS--------VERVDRSRMIAFSGAELPwe--aFRGNGYWHDSVLQAMYNALSRYDTATQGTASMFFEAVVDVLRI 254
gi 488330615 173 FEVNNRsnnsrihlLNNTTYSRATTIHRSRVLhqqnlRFEDELEGSSLLENLYDILTVADTSVWSVGQILYDFIFKVYKS 252
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1175784   225 AGLSDKISAG-LENDVAHVISAVQSIKSATNSLLLDAENEYDRKELSFGGLKDLLTEFRNAVAGAADMPVTILFGQSVSG 303
gi 499196529 255 SGLSDTLSSDqGTQEVHKRFQLAAMMKSFNRMLLLDAKDEYTQKTNHFSGVKEVIEQFMMDISGAADIPATRLFGQSPKG 334
gi 488330615 253 ADVRSLTPQD----KLEIETKMDYQF-RTEAIAIIDKEESLGKESSSVAGIGELLDFVWDYLAGAARMPKTVLKGQEGGT 327
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1175784   304 LAS-GDEDIQNYHESIHRLQETRLRPVLEVLDTLLCNELFGG----QPD--DWWFEFLPLTVVKQEQQVNMLNTFATAAN 376
gi 499196529 335 MNAtGDSDIRNYYDRIKAQQEDELRPVLRVLYAVLFRASVGE----CPQ--DLEIQFNSLWQMSETERASIEKLRAERDQ 408
gi 488330615 328 VTG-AQYDVMNYYSRITAIQENQLRPHLEYLMRCLMWAEDECggrlDPDsiEWSVEFNPLWNVDSKTDAEIRKLTAETDK 406
                        410       420
                 ....*....|....*....|....*.
gi 1175784   377 TLIQNGVVNEYQVANELRESGLFANI 402
gi 499196529 409 IYLAHGVIGPDVPCAELLEQKTYSNL 434
gi 488330615 407 IYIEAGVSDPDDVHEARFGRFGITET 432
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap