Conserved Protein Domain Family
rhamnosyltran

?
TIGR01556: rhamnosyltran 
L-rhamnosyltransferase
This model subfamily is comprised of gamma proteobacteria whose proteins function as L-rhamnosyltransferases in the synthesis of their respective surface polysaccharides. Rhamnolipids are glycolipids containing mono- or di- L-rhamnose molecules. Rhamnolipid synthesis occurs by sequential glycosyltransferase reactions involving two distinct rhamnosyltransferase enzymes. In P.aeruginosa, the synthesis of mono-rhamnolipids is catalyzed by rhamnosyltransferase 1, and proceeds by a glycosyltransfer reaction catalyzed by rhamnosyltransferase 2 to yield di-rhamnolipids. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
Statistics
?
PSSM-Id: 130619
View PSSM: TIGR01556
Aligned: 4 rows
Threshold Bit Score: 390.693
Threshold Setting Gi: 152781
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48587      13 VTFNP---EVEVFKQLIKSIIPQVDQIIIVDNGslCEirSGLEEIVTNYQNLYLISLSDNMGIASAQNYGIKKSFSMESS 89
gi 27735229   10 VTYNP---ELKNLNALITELKEQNCYVVVVDNR--TN--FTLKDKLADIEKVHLICLGRNEGIAKAQNIGIRYSLEKGAE 82
gi 152781     11 ITYNP---DLTILRESYTSLYKQVDKIILIDNN--STnyQELKKLFEKKEKIKIVPLSDNIGLAAAQNLGLNLAIKNNYT 85
gi 576905421   8 VLFNPgddDLEHLGELAAAFP--QLRFLAVDNSphSD---PQRNARLRGQGIAVLHHGNRQGIAGAFNQGLDALFRRGVQ 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48587      90 HVLLLDHDSIPAedmvEKLLSLELKLLSQGr-QVGAVGPTSVDRRTSTRSGFVRKSG-ILIKRIYPDDSKGFVKTDFLIA 167
gi 27735229   83 KIIFFDQDSRIR----NEFIKKLSCYMDNE--NAKIAGPVFIDRDKSHYYPICNIKKnGLREKIHVTEGQTPFKSSVTIS 156
gi 152781     86 YAILFDQDSVLQdngiNSFFFEFEKLVSEEklNIVAIGPSFFDEKTGRRFRPTKFIGpFLYPFRKITTKNPLTEVDFLIA 165
gi 576905421  83 GVLLLDQDSRPG----GAFLAAQWRNLQARngQACLLGPRIFDRGDRRFLPAIHLDG-LTLRQLSLDGLTTPQRTSFLIS 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 48587     168 SGTLIRTEVLHNIGLMKENYFIDHVDTEWCFRAVNCGIELFGCGDAFLNHTLGDSVIRIWMgrwREIPKHSPLRNYYIFR 247
gi 27735229  157 SGTMVSKEVFEIVGMMDEELFIDYVDTEWCLRCLNYGILVHIIPDIKMVHAIGDKSVKICG---INIPIHSPVRRYYRVR 233
gi 152781    166 SGCFIKLECIKSAGMMTESLFIDYIDVEWSYRMRSYGYKLYIHNDIHMSHLVGESRVNLGL---KTISLHGPLRRYYLFR 242
gi 576905421 158 SGCLLTREAYQRLGHFDEELFIDHVDTEYSLRAQALDVPLYVDPRLVLEHRIGTRKTRRLGglsLSAMNHAPLRRYYLAR 237
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|.
gi 48587     248 NTINMVTSTPMSWSWKLAHIYRLMIFFVFFMIAAKPRYRRFIMMIKGGFDG 298
gi 27735229  234 NAFLLLRKNHVPLLLSIREVVFSLIHTTLIIATQKNKIEYMKKHILATLDG 284
gi 152781    243 NYISILKVRYIPLGYKIREGFFNIGRFLVSMIITKNRKTLILYTIKAIKDG 293
gi 576905421 238 NGLLVLRRYARSSPLALLANLPTLTQGLAVLLLERDKLLKLRCLGWGLWDG 288
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap