Conserved Protein Domain Family
myb_SHAQKYF

?
TIGR01557: myb_SHAQKYF 
myb-like DNA-binding domain, SHAQKYF class
This model describes a DNA-binding domain restricted to (but common in) plant proteins, many of which also contain a response regulator domain. The domain appears related to the Myb-like DNA-binding domain described by pfam00249. It is distinguished in part by a well-conserved motif SH[AL]QKY[RF] at the C-terminal end of the motif.
Statistics
?
PSSM-Id: 130620
View PSSM: TIGR01557
Aligned: 10 rows
Threshold Bit Score: 70.1253
Threshold Setting Gi: 4759506
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 4773902    14 NPRMHWTDDLDIRFIQVIEKLGGeESATPKRILSLMGVRDLTISHVKSHLQMYRNKK 70
gi 10177153  223 KRRVVWDEELHQNFLNAVDFLGL-ERAVPKKILDVMKVDYISRENVASHLQVTFLIY 278
gi 3885337   225 KKKIWWTNPLQDLFLQAIQHIGY-DKVVPKKILAIMNVPYLTRENVASHLQKYRLFV 280
gi 13940494  184 KVKVDWTPELHRRFVQAVEQLGI-DKAVPSRILEIMGTDCLTRHNIASHLQKYRSHR 239
gi 9280326   218 NPDLVWTNRLQLVFDDAVVRLGGlFSATPKAINELISEEGLTGDQIRSHLQVLRDRQ 274
gi 7705206    99 KKGVPWTEEEHRMFLLGLQKLGKgDW---RGIARNYVISR-TPTQVASHAQKYFIRQ 151
gi 4759506    22 KQRERWTEDEHERFLEALRLYGR-AW---QRI-EEHIGTK-TAVQIRSHAQKFFTKL 72
gi 14596213   46 KSRESWTEGEHDKFLEALQLFDR-DW---KKI-EDFVGSK-TVIQIRSHAQKYFLKV 96
gi 565492228 180 KQRRCWSSQLHRRFLNALQHLGGpHVATPKQIREFMKVDGLTNDEVKSHLQKYRLHT 236
gi 15225039   86 KARLRWSSDLHDCFVNAVEKLGGpNKATPKSVKEAMEVEGIALHHVKSHLQKFRLGK 142
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap