Conserved Protein Domain Family
gde_arch

?
TIGR01561: gde_arch 
glycogen debranching enzyme, archaeal type, putative
The seed for this model is composed of two uncharacterized archaeal proteins from Methanosarcina acetivorans and Sulfolobus solfataricus. Trusted cutoff is set so that essentially only archaeal members hit the model. The notable exceptions to archaeal membership are the Gram positive Clostridium perfringens which scores much better than some other archaea and the Cyanobacterium Nostoc sp. which scores just above the trusted cutoff. Noise cutoff is set to exclude the characterized eukaryotic glycogen debranching enzyme in S. cerevisiae. These cutoffs leave the prokaryotes Porphyromonas gingivalis and Deinococcus radiodurans below trusted but above noise. Multiple alignments including these last two species exhibit sequence divergence which may suggest a subtly different function for these prokaryotic proteins. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
Statistics
?
PSSM-Id: 130624
View PSSM: TIGR01561
Aligned: 2 rows
Threshold Bit Score: 936.01
Threshold Setting Gi: 15897868
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19916595   21 EWVIGNGLGGYASSTVIGAGTRTYHGLLVAAPENFPGRLLLLSSLDEEISIDKEVYKLATHKYPDNISPEGFNYLSEFIR 100
gi 499225621  10 EWLLPTRTGGYASSTICGINARTYHGYLIVPLNQPHHRFLILSKFEDFLLINGDTYSMSTNYYPGSYYPDGYKYLIKVEK 89
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19916595  101 SPFP--LWVYQAGDFTLKKKVFMVHGSNTTYVLYDIISRKegalLKIFPLVSSRDFNLTARSGYLSFYQKAGPAGVELAS 178
gi 499225621  90 NSNSkiTWHYDFGYSQVEKTLRVHKGYNAITITYIATRGK----FKLCPFITFRSHHLAKKLQNEFFTYEIYPPNTIYIL 165
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19916595  179 SNG---FTFSLSSNLQYHPDPIWYFNLEYDTEKKRGLNFQEDIFNPGYFESKLEPGASRFFVAASTKDISSLTLEQVDKL 255
gi 499225621 166 YEGkriLNFEIHDKYELFNSGYWYYNFIYKLDQELGNNYIEDLYNPFCIVSTSNKISVTVYYDQRPKDLSVEENEHYDIL 245
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19916595  256 YVREANRqnllildskliesfalkllratDSFVVKnhATGENTVIAGYHWYSDWGRDSMISLPGLLLIPYRFEEARSALN 335
gi 499225621 246 KLLSAAG----------------------KDFVVK--GKDGWAIIAGYHWFDEWGRDTFISLEGLLLVDKQYDIAKEIIL 301
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19916595  336 NFARYCRRGLIPNTFPAFGGDPIYNTVDASLWFIHALDRYFAYTQDFLFLSDVWDTVSSIIDNYCAGTDFAIGMDSdYLI 415
gi 499225621 302 KYLNLEKRGMLPNNFISYNGEPVYRGVDISLWAINAIYKTYIYSRDKNFIRKVVDKVLDIIDWYSKGNGVIYNVDN-LIF 380
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19916595  416 WQGPQLTWMDAKVGEWAVTPRAGKACEVNALWYNALKTASYMGTLLGEDISSYETLAAGVASNFENTFWNPESncLFDLI 495
gi 499225621 381 HKGAPRTWMDASYDSRIVTPREGAAVEINALWYNALRVTEFLLNELGEKAEYLSEKAESVKKSFAEKFISQDG--LYDYI 458
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19916595  496 HQDEAGnqvkDPAIRPNQIFAVSLPYTMLSPE-KEKAIVDRVEKDLLTPFGLKTLSSDHPLYKGQYRGDALTRDtayhng 574
gi 499225621 459 NWDNIP----DKSIRPNQIFSISLPFPIIDDKsIASKILTLIESKLLRQYGLSSLSREDPNYKPVYKGDRRSRE------ 528
                        570
                 ....*....|....*
gi 19916595  575 TVWPWLLGAYVKAYL 589
gi 499225621 529 SLPQWTHMALVTRRL 543
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap