2FIY


Conserved Protein Domain Family
FdhE

?
TIGR01562: FdhE 
Click on image for an interactive view with Cn3D
formate dehydrogenase accessory protein FdhE
This model describes an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulfur clusters and cytochrome b556, it is likely to have something to do with the insertion of cofactors. The only sequence scoring between trusted and noise is that from Aquifex aeolicus, which shows certain structural differences from the proteobacterial forms in the alignment. However it is notable that A. aeolicus also has a sequence scoring above trusted to the alpha subunit of formate dehydrogenase (TIGR01553).
Statistics
?
PSSM-Id: 130625
View PSSM: TIGR01562
Aligned: 4 rows
Threshold Bit Score: 466.334
Threshold Setting Gi: 90109452
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2FIY_A         2 SRTILQPGQIEAAAN-----IPPHLHQPSRDLFARRGERLLQLAEGHPMGDYLRLVAGLCRLQQALLDNPPALAPLDpER 76
gi 9951077     2 SRTILQPGQIEAAAN-----IPPHLHQPSRDLFARRGERLLQLAEGHPMGDYLRLVAGLCRLQQALLDNPPALAPLDpER 76
gi 499269610   2 SVSPVQPDPSVIGGVp---kAPFVLKPNLARLFNDRASRFEALAQGSHLAPYLNFLAGITRIQSELVSALPPPEPVPaDR 78
gi 416982      2 SIRIIPQDELGSSEKrtadmIPPLLFPRLKNLYNRRAERLRELAENNPLGDYLRFAALIAHAQEVVLYDHPLEMDLT-AR 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2FIY_A        77 LRKSREHGMPPLAYDLLVREGAWLPWLDALLAGYPAPAN-AAVGAALEQLREAEEGQRKAWAIALLSGQFDLLPAALVPF 155
gi 9951077    77 LRKSREHGMPPLAYDLLVREGAWLPWLDALLAGYPAPAN-AAVGAALEQLREAEEGQRKAWAIALLSGQFDLLPAALVPF 155
gi 499269610  79 VERARANAMPPIDRAAMGGSPDCREVLQQFFEKAEALEKpAAAAEALAQVRTADEEMLTWMIGNVMADDLPVESLAHHLY 158
gi 416982     81 IKEASAQGKPPLDIHVLPRDKHWQKLLMALIAELKPEMS-GPALAVIENLEKASTQELEDMASALFASDFSSVSSDKAPF 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2FIY_A       156 LGAALQVAWSHWLLGLEEGAVVET-ESrtLCPACGSPPMAGMIRQGgKETGLRYLSCSLCACEWHYVRIKCSHCEESKHL 234
gi 9951077   156 LGAALQVAWSHWLLGLEEGAVVET-ESrtLCPACGSPPMAGMIRQGgKETGLRYLSCSLCACEWHYVRIKCSHCEESKHL 234
gi 499269610 159 VAAAMQIQAARLAAGLDGSRLVPIrVG--VCPACGGRPVASMVIGFhGAEGARYASCSCCATMWNEVRVKCLACGSTKGI 236
gi 416982    160 IWAALSLYWAQMANLIPGKARAEYgEQrqYCPVCGSMPVSSMVQIG-TTQGLRYLHCNLCETEWHVVRVKCSNCEQSGKL 238
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
2FIY_A       235 AYLSLEHdgqpaEKAVLRAETCPSCQGYLKQFYLEFDRHADALADDLASLALDMRLAEDGYLRRSPNLLLAP 306
gi 9951077   235 AYLSLEHdgqpaEKAVLRAETCPSCQGYLKQFYLEFDRHADALADDLASLALDMRLAEDGYLRRSPNLLLAP 306
gi 499269610 237 GYQAVETg---dEEATVKAEVCDTCNSWMKILYQNKNPSLDVVADDVASLGLDLLMKDTEYKRAGFDPFLMG 305
gi 416982    239 HYWSLDD-----EQAAIKAESCDDCDTYLKILYQEKDPKIEAVADDLASLVLDARMEQEGYARSSINPFLFP 305
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap