Conserved Protein Domain Family
Mo_ABC_porter

?
TIGR01581: Mo_ABC_porter 
NifC-like ABC-type porter
This model describes a clade of ABC porter genes with relatively weak homology compared to its neighbor clades, the molybdate (TIGR02141) and sulfate (TIGR00969) porters. Neighbor-Joining, PAM-distance phylogenetic trees support the separation of the clades in this way. Included in this group is a gene designated NifC in Clostridium pasturianum. It would be reasonable to presume that NifC acts as a molybdate porter since the most common form of nitrogenase is a molybdoenzyme. Several other sequences falling within the scope of this model are annotated as molybdate porters and one, from Halobacterium, is annotated as a sulfate porter. There is presently no experimental evidence to support annotations with this degree of specificity.
Statistics
?
PSSM-Id: 130643
View PSSM: TIGR01581
Aligned: 6 rows
Threshold Bit Score: 209.561
Threshold Setting Gi: 15790560
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7387894    29 IAIRVDWPRFWALITTPSSQTALLLSVKTAAASTVLCVLLGVPMALVLARSR-GRLVRSLRPLILLPLVLPPVVGGIALL 107
gi 19914099   54 LLFVLTPSEILSALLSEEMFYSMKLSMLTSFASTFSVMCCSIPTAYALSRFS-FPGKSLIKAILGLPMAFPELVMGLALL 132
gi 128236     53 MIRYSGGSHIIQTLYDQDNIKTIILSFVTSLIALIFTFIIGTPTAFCINFVRnKVLSKILDIFVEIPVVLPPAVAGIALL 132
gi 499209480  36 LISQLNFSFFLLVLTDPELHFALWMSLATSILSLLLAIFIAIPSAWVMSQVR-LPLQKLIDTFLDLPMVLPPLVTGLSLL 114
gi 499191888  30 llTRGLTASFWPALASRAVGDALRVSLLTTGITLLLTVTLVTPVAWLLARFD-FPGKPVLETLLDLPIVLPPVVAGVGLL 108
gi 499205622  35 FLAHTGAADIGSQLTAPDARAAIRTSLATATAATVLATVFGVPLAYTLARAT-FPGKRLVNGLVVLPLVVPPLVGGTMLL 113
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7387894   108 YAFGRlGLIGRYLEAAGISIAFSTAAVVLAQTFVSLPYLVISLEGAARTAGADYEVVAATLGARPGTVWWRVTLPLLLPG 187
gi 19914099  133 LLFGH-GFLGPYLEAAGIKVTFTKLGIVVAQFFVAFPYAVRVIYSTFEDINPRYEQVSRSFGYGEFETFRHVTLPMARSG 211
gi 128236    133 LAFGKnGVVGNFLSNHGINVIFTSTAVIIAQFFVSSALYVRVLRDSVKSVPIELFEVSYVLGAGKIETIIKIMIPMLKKS 212
gi 499209480 115 LLFNS-QGILSQFIPIISQWIFSPLGIIVAQTYIASSIMLRNARGTFSSLDSGYRLAAYNLGLSPLQTLLKIELPMCWKP 193
gi 499191888 109 LTFGRgGLLGPALELAGIQLAFSTAAVVLAQLFVSAPFYLRTARAGFQAVNRDAEDAARTDGASDGQVFRLITWPLAFPF 188
gi 499205622 114 TVVGRfTPLGAWAAAAGVPLTNSAIGVVLAQTFVAAPFLVVAARSGFDGVDPRFEDAARSLGRGPLATFWTVSIPLARPA 193
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 7387894   188 VVSGSVLAFARSLGEFGATLTFAGSRQGVTRTLPLEIYLQRVTD-PDAAVALSLLLVVVA--ALVV 250
gi 19914099  212 LFASSVITFARCIGAFGAVLVLAGGSYMHTEVLPVTLYLNISYGnLEMAVTSGILLMGIAflAILS 277
gi 128236    213 IVSGLILAWIRSLGEFGATLMFAGNIIGKTRTIPLQIYTYMQDD-IKMATAFATILYIMTfvLLLL 277
gi 499209480 194 LLCGAILAWSRAIGEFGATLMLAGATRFKTETLPMAVYLNIASGdFEIAVGASLWLLFIAacLLLV 259
gi 499191888 189 LLEGLVLAWARALGEFGATILFAGSLQGQTRTVTLAIYAALESDlAPALVLSAVMVLVAFglLLLV 254
gi 499205622 194 ILAGIVLTFARALGEFGATMMVATT----PRTVPIRIWIAFRSDgIDAVVPLAVALLVITlfvvga 255
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap