Conserved Protein Domain Family
citF

?
TIGR01584: citF 
citrate lyase, alpha subunit
This is a model of the alpha subunit of the holoenzyme citrate lyase (EC 4.1.3.6) composed of alpha (EC 2.8.3.10), beta (EC 4.1.3.34), and acyl carrier protein subunits in a stoichiometric relationship of 6:6:6. Citrate lyase is an enzyme which converts citrate to oxaloacetate. In bacteria, this reaction is involved in citrate fermentation. The alpha subunit catalyzes the reaction Acetyl-CoA + citrate = acetate + (3S)-citryl-CoA. The seed contains an experimentally characterized member from Lactococcus lactis subsp. lactis. The model covers both Gram positive and Gram negative bacteria. It is quite robust with queries scoring either quite well or quite poorly against the model. There are currently no hits in between the noise cutoff and trusted cutoff. [Energy metabolism, Fermentation]
Statistics
?
PSSM-Id: 130646
View PSSM: TIGR01584
Aligned: 4 rows
Threshold Bit Score: 861.452
Threshold Setting Gi: 31322797
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18144810  24 KGEFALEPKGNIQGRKITATFCGKNKKLSSIAESIEKTGLKDGMTISFHHHFRAGDYIIRMVMKEIANLGIKNLNLCVSS 103
gi 19715031  26 KGVDAIKPTKNKAGAKLRMRIQDEPKMVASIEEAIKKSGLKDGMTISFHHHMRNGDTVVNEVLDIIAKMGIKDLTLAPSS 105
gi 1168950   15 RSVYQAVPK-----SESLSRTAKDRKLCTSLEEAIKRSGLKDGMTVSFHHAFRGGDFVVNMVMNKIAEMGFKNLTLASSS 89
gi 31322797  29 ESVEVKDLVIERVSAKVRQSVK-PNKLVDSLEEVVLKT-VKDGMTISFHHHFREGDYVFNKVMRIIIDHGFKDLRIAPSS 106
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18144810 104 LTSAH-EFLIDYIKDGTVTGIETSGIRGKLGEEISKGIMKKPVIIRSHGGRARAIEAGDTKIDVAFLGVPCSDEYGNANG 182
gi 19715031 106 LSSCH-GPVIDHIKSGVVTGIQSSGLREPLGDEISKGILKKPVIIRSHGGRARAVEDGELHIDVAFIAAPSCDEMGNMNG 184
gi 1168950   90 LIDSH-FPIVEHIKNGVVTKIYSSGLRGELAEQISRGLLNEPVNIHSHGGRVHLVKSGELKIDVAFLGVPCCDTFGNANG 168
gi 31322797 107 LTNVMnDILVEAIEKGVVTNITSSGMRGTLGDVVSHGALKNPVIFRSHGGRARAIETGEIHIDVAFLGTPNADEMGNANG 186
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18144810 183 IHGKSQCGSLGYAIIDSKYADKVVLITDTIMPYPNVPASISQQDVDYIVEVEEIGDPNGIASGATRFTKDPKELLIAKYA 262
gi 19715031 185 RTGKSACGSMGYAIVDAQYADYVIAITDNLVPFPNLPASIDQTLVDSVVVVDSIGDPKKIVSGAIRDSDNPRDLLIAKNA 264
gi 1168950  169 FTGKSKCGSLGYARVDAEYADKVVLLTEEFVEYPHHPISIAQDQVDLIVQVEAVGDPKKIGGGATRMTTNPRELLIARKC 248
gi 31322797 187 MDGKAPFGSLGYALMDAQYADTVVAITDSLVSYPNTPASIKQTQVDYVVKIDAVGNPDKIGAGATRFTKDPKELKIASMV 266
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18144810 263 SAVIEASGYLKDGFSIQAGTGGASLAVARFLKEKMEEKNIKASFGLGGISKQFVDLHEEGFIGTLFDVQGFDLKAVESIG 342
gi 19715031 265 VDVIINSGYFKDGFVYQTGTGGASLSVTKLLKEEMIKQNIKASLGLGGITSQLVSLHEEGLMDALFDTQSFDLDAVRSIA 344
gi 1168950  249 AEVIFASGYFKDGFSLQTGSGGAALAVTRFLEEKMRRENITADFALGGITASMVALHEAGLIKKLLDVQSFDSVAAESLA 328
gi 31322797 267 NDVIVNSPYFKNGFSFQTGTGGAALAVTRFLRQSMIDHNVKATFGLGGITKPMVDLLEEGLVDKLMDVQDFDGGSAQSMH 346
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18144810 343 KNNKHVEIDASLYANPHNKGCIANKLDIVILSALEVDKNFNVNVITGSDGYIRGASGGHSDTAAGAKLSMIVSPLVRGRI 422
gi 19715031 345 ENPKHYEISASFYANPNTPGPAVNNLTFVMLSALEIDKDFNVNVMTKSDGTINQAVGGHQDTAAGARISVILAPLMRARI 424
gi 1168950  329 RNPNHIEVSANQYANYSSKGASVERLDMVILSALEIDTKFNVNVLTGSDGVIRGASGGHCDTAASAQVAIIVAPLVRGRI 408
gi 31322797 347 LNKNQQEIDASWYADPANKGAMVDKLDVVILSALEIDTKFNVNVMSGSDGVIRGAIGGHQD-AGTAKLTIISAPLVRGRI 425
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18144810 423 PTIVEKVNTVITPGESIDVIVTERGVAINdklSKNKELKERLEsNKNIPILSIEELHEKALKITGTPEPIKYEDRVVGIV 502
gi 19715031 425 PIIVDKVTTVCTPGEAVDVICTDYGIVVN---PRRKDLIESLT-KAGVELKTIEEMKEMAEQLTGKPDPVEFTDEIVGVV 500
gi 1168950  409 PTVVENVITCVTPGENVDILVTDHGVAVN---PKRPDLIEALS-KTDIPLFTIEQLCERAYSITGKPKEIEFTNKPVAVV 484
gi 31322797 426 ATVVPDVTTVITPGDSIDVLVTEIGIAIN---PKRTDLLDKLSnIPGLPVYTIEELQKIAEEKLGKPEPLEFTDKVVALI 502
                       490
                ....*....|....*.
gi 18144810 503 EYRDGSIIDVIHKVKE 518
gi 19715031 501 EYRDGSIIDVIKKVKE 516
gi 1168950  485 RYRDGSVIDTVYQVKD 500
gi 31322797 503 EYRDGSLLDIIREVKD 518
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap